MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ansieau-2002-1 The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de J. Biol. Chem. (0021-9258) 2002 ansieau-2002-2 The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. human-qt_6 Homo sapiens qt_6 Quail Japanese fibrosarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de J. Biol. Chem. (0021-9258) 2002 ansieau-2002-3 The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de J. Biol. Chem. (0021-9258) 2002 e1a_ade05 Early E1A protein Early E1A 32 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP zmy11_human Zinc finger MYND domain-containing protein 11 BRAM1 Bone morphogenetic protein receptor-associated molecule 1 ZMYND11 Adenovirus 5 E1A-binding protein BS69 Protein BS69 protein protein human Homo sapiens Human MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR ebna2_ebvb9 Epstein-Barr nuclear antigen 2 EBNA2 BYRF1 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSPLDRDPLGYDVGHGPLASAMRMLWMANYIVRQSRGDRGLILPQGPQTAPQARLVQPHVPPLRPTAPTILSPLSQPRLTPPQPLMMPPRPTPPTPLPPATLTVPPRPTRPTTLPPTPLLTVLQRPTELQPTPSPPRMHLPVLHVPDQSMHPLTHQSTPNDPDSPEPRSPTVFYNIPPMPLPPSQLPPPAAPAQPPPGVINDQQLHHLPSGPPWWPPICDPPQPSKTQGQSRGQSRGRGRGRGRGRGKGKSRDKQRKPGGPWRPEPNTSSPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPILFPDDWYPPSIDPADLDESWDYIFETTESPSSDEDYVEGPSKRPRPSIQ mint Involved in latent cycle. Transactivates the expression of LMP-1 q20747_caeel F54B11.11 CELE_F54B11.11 protein protein caeel Caenorhabditis elegans MLLKSTIFLFFLDIVHAQIGAQCQSRTVNVTSIQGTIPYPSVNLVKIDQWESCYYNFIIPLGYALQFQISYTMDKGDVLTITNSLGVTVGFTNFTGVQKDVYWCTAGDSTLRVTSFSGNLAFLISYQFYSLKSYFPLMRYSGDYFQVSQIPPAQYLIFYGSKLALTLAANTAAESLKNLDRYMLYIGTDVMQYPASGTLADLINGTQFYDNGRMYYANWITIVNFYDDFKSDAYIIANDGPEITSSYQFFITPPNNFTSKVLFDVTDGGGAVTFACPDCTNFYINQLVFDTMLTSPNGYIAFQGNTPSQIYMAKVINYNATSFNPNQLPQIIPTNKFTLLMYKSLFTIELYSGDEYSAWKQPRVGRTGLISSVSLWETVWDSATFQYEIRDDSQLYNFNVNIDNMNFTGVNFLNLCIGSGPGYNNQVNLTYPPALNSSVTSIGNYLTTSANFTMRGYITLYYEITAASGTTTQPILSTMTSSTTKTLTSTTTITTTKANILTTTATTTTPPVTSAPATTFITPVPFTPPVTNSTTIYSSNTGSTLSTTIGLPITQVSVQTTTQTAPLKVVLLNVLSFVLIAELFKNLL mint taf1b_caeel TATA box-binding protein-associated factor RNA polymerase I subunit B TATA box-binding protein-associated factor 1B F23H11.2 protein protein caeel Caenorhabditis elegans MHSAKNEKCNACGGYRFSVNDGFKYCDRCGALFENFEELEEEEGGLQQTVGQGKVKVRKNDDQKRVRNNAAPVNLPKAQVMREALEKRSDFLQQQAIKGEELELPHDATPDYLYRLALRLFSFTQILAKSGHILVHELNFESRVQENILATFQKYLAHCQVAFCHSEQCGNDEHLRFVAVMENLRYEQEEREEKQRKRMAKRGKGVNALSKSAAAWTLLTQGNITEHLDIASDEDGDQDAQGGQQLDDLTLETTQNPDESIRVNDTTMGFVRKVTTALSKEALRRASQLILNLEMLVAILHSALMSSGYQTILTSDVVRWIREDRFRISRRSIRLIRQSQPERMKQGEVVKPTIVDYAEPFLRFPLYEIMRTCTIFHQSLKLASSMAPQSFESMSARLVDNLNLPSDILSRMLILESIIPCDVSPQLLKQVDVDMGYNCGQLAAMSPNVYYSGFLTSFGRKERGTQDADFCDEVLLSPDAKLIAYLLLTLRLTFQLDNAQCALQDDQYFDVDSWIHQLEMRIKCWQGHNMSLVMRSSSHVPEMVVDPPFGTNYLFHQEKGAPQVSCRRRQAGFQKCIPTEMSFNSTSTLPTVFDVRHMGLLTERCQMEALISPVKFQRTVLGNEIERDPLTFENVDRQSKNTFFKHFSAFKTTESCDTFEEYFPCAKNYLLFKRPDWIQNCTARQTHFNPVTGPIRFYLSNQSCDDLLGTAATSFSRRFQFLLDALSLIIGEDKKAVYAAFVMLEMHLTSSERIQSIRDDLLTSSPITLKCQKFRNSTHHIPRKYGVISEVPIDRIENLRYFRLSRQFFEHEEMPTTINMELIDYRNQEIRDSVTETEVQRAQNRIMKLCYEFEQFFGILAVKFW p03255-2 Early E1A protein Early E1A 32 kDa protein 243R S-E1A protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP No experimental confirmation available. zmynd11-e1a 490490 e1a_ade05 490493 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 zmy11_human 490494 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1B F2A homomint mint zmynd11-ebna2 490490 ebna2_ebvb9 490495 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 zmy11_human 490494 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1B F2B homomint mint q20747-e1a 490490 q20747_caeel 490496 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 e1a_ade05 490493 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association false false false F1E mint q20747-ebna2 490490 q20747_caeel 490496 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 ebna2_ebvb9 490495 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association false false false F1E mint taf1b-ebna2 490490 ebna2_ebvb9 490495 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 o01914_caeel 490497 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1E mint taf1b-e1a 490490 o01914_caeel 490497 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 e1a_ade05 490493 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association false false false F1E mint e1a-zmynd11-1 490491 zmy11_human 490494 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 e1a_ade05 490493 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03255:p.Leu115Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3A F1C homomint mint p03255_2-zmynd11 490491 zmy11_human 490494 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 p03255-2 490498 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03255-2:p.Leu115Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3A homomint mint zmynd11-ebna2-1 490492 ebna2_ebvb9 490495 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 zmy11_human 490494 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1D homomint mint