HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html zhang-2001-5 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhang Y., Jones C. Virus - Publications including interactions involving viral proteins Based on an email from the author, the BHV-1 strain cooper was stated to have been used in the study. Since no entry was found for the ICP0 from strain cooper, the Uniprot accession P29128 (ICP0_BHV1J) has been used (based on BLAST of the ICP0 sequence from fig. 6 and 100% match with P29128). cjones@unlnotes.unl.edu Journal of virology 2001 imex curation Only protein-protein interactions imex curation zhang-2001-6 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Jones C. Virus - Publications including interactions involving viral proteins Based on an email from the author, the BHV-1 strain cooper was stated to have been used in the study. Since no entry was found for the ICP0 from strain cooper, the Uniprot accession P29128 (ICP0_BHV1J) has been used (based on BLAST of the ICP0 sequence from fig. 6 and 100% match with P29128). cjones@unlnotes.unl.edu Journal of virology 2001 imex curation Only protein-protein interactions imex curation hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA icp0_bhv1j E3 ubiquitin-protein ligase ICP0 BICP0 IER 2.9/ER2.6 P135 protein RING-type E3 ubiquitin transferase ICP0 protein protein BoHV-1 Bovine herpesvirus 1.1 (strain Jura) Infectious bovine rhinotracheitis virus MAPPAAAPELGSCCICLDAITGAARALPCLHAFCLACIRRWLEGRPTCPLCKAPVQSLIHSVASDECFEEIPVGGGPGADGALEPDAAVIWGEDYDAGPIDLTAADGEASGAGGEAGAADGSEAGGGAGGAEEAGEARGAGAGRAAGAAGGRAGRGADAAQEFIDRVARGPRLPLLPNTPEHGPGAPYLRRVVEWVEGALVGSFAVTARELAAMTDYVMAMLAECGFDDDGLADAMEPLIGEDDAPAFVRSLLFVAARCVTVGPSHLIPQQSAPPGGRGVVFLDTSDSDSEGSEDDSWSESEESSSGLSTSDLTAIDDTETEPETDAEVESRRTRGASGAARARRPAERQYVSTRGRQTPAVQPAPRSLARRPCGRAAAVSAPPSSRSRGGRRDPRLPAAPRAAPAAQARACSPEPREEGRGAGLGVAAGETAGWGAGSEEGRGERRARLLGEAGPPRVQARRRRRTELDRAPTPAPAPAPAPAPISTVIDLTANAPARPADPAPAAAPGPASAGAQIGTPAAAAAVTAAAAAPSVARSSAPSPAVTAAATSTAAAISTRAPTPSPAGRAPAADPRRAGAPALAGAARAEVGRNGNPGRERRPASAMARGDLDPGPESSAQKRRRTEMEVAAWVRESLLGTPRRSSAALAPQPGGRQGPSLAGLLGRCSGGSAWRQ bicp0-hdac1-1 1876145 N/A 1876147 unspecified role unspecified role bait bait N/A 1876148 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7 hdac1-bicp0-1 1876146 N/A 1876147 unspecified role unspecified role prey prey N/A 1876148 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7