HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html liu-2001-12 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu HC., Kung HJ., Fulton JE., Morgan RW., Cheng HH. Virus - Publications including interactions involving viral proteins hcheng@pilot.msu.edu Proceedings of the National Academy of Sciences of the United States of America 2001 IMEx imex curation Only protein-protein interactions imex curation liu-2001-10 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu HC., Kung HJ., Fulton JE., Morgan RW., Cheng HH. Virus - Publications including interactions involving viral proteins hcheng@pilot.msu.edu Chicken cDNA splenic T cell library Proceedings of the National Academy of Sciences of the United States of America 2001 IMEx imex curation Only protein-protein interactions imex curation liu-2001-11 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu HC., Kung HJ., Fulton JE., Morgan RW., Cheng HH. Virus - Publications including interactions involving viral proteins hcheng@pilot.msu.edu Proceedings of the National Academy of Sciences of the United States of America 2001 IMEx imex curation Only protein-protein interactions imex curation liu-2001-13 chick Gallus gallus (Chicken) Chicken confocal microscopy confocal microscopy immunostaining immunostaining Liu HC., Kung HJ., Fulton JE., Morgan RW., Cheng HH. Virus - Publications including interactions involving viral proteins hcheng@pilot.msu.edu Proceedings of the National Academy of Sciences of the United States of America 2001 IMEx imex curation Only protein-protein interactions imex curation q69283_9alph SORF2 MDV087 protein protein Gallid herpesvirus 2 Gallid herpesvirus 2 MQRQTGHMEDKKRTGLESQGTENAFSDGRDGKDGLLHEGINEPILIPSTIADLEGIRELVRKFRGRLLPFEKCPDFCLRIGGLEASFHKGQEELLEYCEALYLPQPVKMEIVGIVDDVPCLATGMQLLILVAEGGEVYAYEEDTLHKLATSFSEFLEIGVKSLGREVYHCGEYIEQVVH soma_chick Somatotropin GH Growth hormone protein protein chick Gallus gallus (Chicken) Chicken MAPGSWFSPLLIAVVTLGLPQEAAATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI gh-sorf2-1 1857934 N/A 1857938 unspecified role unspecified role prey prey N/A 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. N/A 1857939 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false 2 sorf2-gh-3 1857934 N/A 1857938 unspecified role unspecified role bait bait chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. N/A 1857939 unspecified role unspecified role prey prey N/A 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2 sorf2-gh-1 1857935 N/A 1857938 unspecified role unspecified role bait bait N/A 1857939 unspecified role unspecified role prey prey physical association physical association false false false no figure sorf2-gh-2 1857936 N/A 1857938 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1857939 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. physical association physical association false false false 1 gh-sorf2-2 1857937 N/A 1857938 unspecified role unspecified role neutral component neutral component N/A 1857939 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4