MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint feng-2001-2 Caveolin-1 associates with TRAF2 to form a complex that is recruited to tumor necrosis factor receptors. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Feng X., Gaeta ML., Madge LA., Yang JH., Bradley JR., Pober JS. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2001 feng-2001-1 Caveolin-1 associates with TRAF2 to form a complex that is recruited to tumor necrosis factor receptors. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Feng X., Gaeta ML., Madge LA., Yang JH., Bradley JR., Pober JS. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2001 cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL cav1-traf2-1 6842 cav1_human 6844 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 traf2_human 6845 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false homomint mint cav1-traf2-2 6842 traf2_human 6845 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 cav1_human 6844 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint cav1-traf2 6843 cav1_human 6844 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 traf2_human 6845 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false homomint mint