HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html aoki-2000-3 Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. in vitro In vitro pull down pull down autoradiography autoradiography Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp J. Virol. (0022-538X) 2000 imex curation Only protein-protein interactions imex curation aoki-2000-1 Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp Human liver cDNA J. Virol. (0022-538X) 2000 imex curation Only protein-protein interactions imex curation aoki-2000-2 Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp J. Virol. (0022-538X) 2000 imex curation Only protein-protein interactions imex curation aoki-2000-4 Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp J. Virol. (0022-538X) 2000 imex curation Only protein-protein interactions imex curation aoki-2000-5 Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp J. Virol. (0022-538X) 2000 imex curation Only protein-protein interactions imex curation 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ o92972-pro_0000278742 Core protein precursor protein protein hcvj4 Hepatitis C virus genotype 1b (strain HC-J4) (HCV) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKASERSQPRGRRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASA 2 191 1433b_rat 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Prepronerve growth factor RNH-1 Ywhab protein protein rat Rattus norvegicus (Rat) Rat MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN bmh1_yeast Protein BMH1 YER177W BMH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK 0A234167E313688B mrcka_human Serine/threonine-protein kinase MRCK alpha CDC42BPA KIAA0451 Myotonic dystrophy kinase-related CDC42-binding kinase alpha DMPK-like alpha CDC42-binding protein kinase alpha protein protein human Homo sapiens Human MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTPASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP core-1433e-2 1499678 n/a 1499683 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 1499684 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeast Saccharomyces cerevisiae Baker's yeast physical association physical association false false false Fig. 2A and 2B Treatment with PKA or PKC enhance interaction core-1433b-1 1499678 n/a 1499685 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 1499684 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeast Saccharomyces cerevisiae Baker's yeast physical association physical association false false false Fig. 2A core-bmh1-1 1499678 n/a 1499684 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeast Saccharomyces cerevisiae Baker's yeast n/a 1499686 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false Fig. 2A core-1433e-4 1499679 n/a 1499683 unspecified role unspecified role prey prey n/a 1499684 unspecified role unspecified role bait bait physical association physical association false false false Results core-mrcka-1 1499679 n/a 1499684 unspecified role unspecified role bait bait n/a 1499687 unspecified role unspecified role prey prey physical association physical association false false false Results core-1433e-1 1499680 n/a 1499683 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1499684 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O92972-PRO_0000278742:p.Glu53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false 1499713 1499711 physical association physical association false false false Fig. 1 core-1433e-3 1499681 n/a 1499683 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1499684 unspecified role unspecified role bait bait O92972-PRO_0000278742:p.Glu53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2C core-1433e-5 1499682 n/a 1499683 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1499684 unspecified role unspecified role prey prey O92972-PRO_0000278742:p.Glu53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2C