HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html tu-1999a-3 Hepatitis C virus RNA polymerase and NS5A complex with a SNARE-like protein. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tu H., Gao L., Shi S.T., Taylor D.R., Yang T., Mircheff A.K., Wen Y., Gorbalenya A.E., Hwang S.B., Lai M.M. Virus - Publications including interactions involving viral proteins Interferon-treated HepG2 cell cDNA Virology (0042-6822) 1999 imex curation Only protein-protein interactions imex curation tu-1999a-4 Hepatitis C virus RNA polymerase and NS5A complex with a SNARE-like protein. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast confocal microscopy confocal microscopy immunostaining immunostaining Tu H., Gao L., Shi S.T., Taylor D.R., Yang T., Mircheff A.K., Wen Y., Gorbalenya A.E., Hwang S.B., Lai M.M. Virus - Publications including interactions involving viral proteins Interferon-treated HepG2 cell cDNA Virology (0042-6822) 1999 imex curation Only protein-protein interactions imex curation tu-1999a-2 Hepatitis C virus RNA polymerase and NS5A complex with a SNARE-like protein. in vitro In vitro pull down pull down autoradiography autoradiography Tu H., Gao L., Shi S.T., Taylor D.R., Yang T., Mircheff A.K., Wen Y., Gorbalenya A.E., Hwang S.B., Lai M.M. Virus - Publications including interactions involving viral proteins Interferon-treated HepG2 cell cDNA Virology (0042-6822) 1999 imex curation Only protein-protein interactions imex curation tu-1999a-1 Hepatitis C virus RNA polymerase and NS5A complex with a SNARE-like protein. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tu H., Gao L., Shi S.T., Taylor D.R., Yang T., Mircheff A.K., Wen Y., Gorbalenya A.E., Hwang S.B., Lai M.M. Virus - Publications including interactions involving viral proteins Interferon-treated HepG2 cell cDNA Virology (0042-6822) 1999 imex curation Only protein-protein interactions imex curation p27958-pro_0000037577 RNA-directed RNA polymerase protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRKKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLAPPHSAKSKFGYGAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGLSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCRASRVLTTSCGNTLTRYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRAWSVRARLLARGGKAAICGKYLFNWAVRTKLKLTPITAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 vapa-ns5b-2 1454432 n/a NS5B 1454436 unspecified role unspecified role prey prey n/a VAP-33 1454437 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 ns5a-vap33-2 1454432 n/a VAP-33 1454437 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a NS5A 1454438 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3 ns5a-ns5b-vap33-1 1454432 n/a 1454438 unspecified role unspecified role prey prey n/a VAP-33 1454437 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS5B 1454436 unspecified role unspecified role prey prey association association false false false Fig. 3 vapa-ns5b-5 1454433 n/a VAP-33 1454437 unspecified role unspecified role neutral component neutral component n/a NS5B 1454436 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 4 ns5a-vapa-5 1454433 n/a VAP-33 1454437 unspecified role unspecified role neutral component neutral component n/a NS5A 1454438 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 4 ns5a-ns5b-3 1454433 n/a NS5A 1454438 unspecified role unspecified role neutral component neutral component n/a NS5B 1454436 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 4 ns5a-vap33-1 1454434 n/a NS5A 1454438 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a VAP-33 1454437 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2 vapa-ns5b-1 1454434 n/a VAP-33 1454437 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a NS5B 1454436 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2 ns5a-vap33-4 1454435 n/a NS5A 1454438 unspecified role unspecified role bait bait n/a VAP-33 1454437 unspecified role unspecified role prey prey physical association physical association false false false Results