MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint qinyu-2013-2 FOXO6 promotes gastric cancer cell tumorigenicity via upregulation of C-myc. human-snu-16 Homo sapiens snu-16 snu-16 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qinyu L., Long C., Zhen-Dong D., Min-Min S., Wei-Ze W., Wei-Ping Y., Cheng-Hong P. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease rjqinyuli@gmail.com. FEBS Lett. (0014-5793) 2013 imex curation Only protein-protein interactions qinyu-2013-1 FOXO6 promotes gastric cancer cell tumorigenicity via upregulation of C-myc. human-snu-16 Homo sapiens snu-16 snu-16 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qinyu L., Long C., Zhen-Dong D., Min-Min S., Wei-Ze W., Wei-Ping Y., Cheng-Hong P. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease rjqinyuli@gmail.com. FEBS Lett. (0014-5793) 2013 imex curation Only protein-protein interactions qinyu-2013-3 FOXO6 promotes gastric cancer cell tumorigenicity via upregulation of C-myc. human-gastric Homo sapiens gastric tissue gastric gastric tissue ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qinyu L., Long C., Zhen-Dong D., Min-Min S., Wei-Ze W., Wei-Ping Y., Cheng-Hong P. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis rjqinyuli@gmail.com. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease foxo6_human Forkhead box protein O6 FOXO6 protein protein human Homo sapiens Human MAAKLRAHQVDVDPDFAPQSRPRSCTWPLPQPDLAGDEDGALGAGVAEGAEDCGPERRATAPAMAPAPPLGAEVGPLRKAKSSRRNAWGNLSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIRVQNEGTGKSSWWMLNPEGGKTGKTPRRRAVSMDNGAKFLRIKGKASKKKQLQAPERSPDDSSPSAPAPGPVPAAAKWAASPASHASDDYEAWADFRGGGRPLLGEAAELEDDEALEALAPSSPLMYPSPASALSPALGSRCPGELPRLAELGGPLGLHGGGGAGLPEGLLDGAQDAYGPRPAPRPGPVLGAPGELALAGAAAAYPGKGAAPYAPPAPSRSALAHPISLMTLPGEAGAAGLAPPGHAAAFGGPPGGLLLDALPGPYAAAAAGPLGAAPDRFPADLDLDMFSGSLECDVESIILNDFMDSDEMDFNFDSALPPPPPGLAGAPPPNQSWVPG mint homomint myc_human_gene Human c-myc gene gene gene human Homo sapiens Human hnf4a_human Hepatocyte nuclear factor 4-alpha Transcription factor HNF-4 Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 HNF4A HNF4 NR2A1 TCF14 protein protein human Homo sapiens Human MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI foxo6-myc 1388740 n/a 1388743 unspecified role unspecified role bait bait n/a 1388744 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5c, Suppl. Fig. S3 anti-HNF4 siRNA A8MYZ6 increases expression at RNA level of ENSG00000136997 A8MYZ6 increases expression at protein level of ENSG00000136997 P41235 increases binding of A8MYZ6 to ENSG00000136997 hnf4a-myc 1388740 n/a 1388744 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1388745 unspecified role unspecified role bait bait association association false false false Fig. 5d, 5e, Suppl. Fig. S2a, S3 anti-FOXO6 siRNA Overexpression of FOXO6 increased binding of HNF4 to c-Myc promoter DNA; however, the origin of the FOXO6 expression construct could not be determined. According to the figure legend (5e), cells are transfected with siRNA targeting HNF4; however, both the text and figure clearly indicate that cells are transfected with siRNA targeting FOXO6. P41235 increases expression at RNA level of ENSG00000136997 P41235 increases expression at protein level of ENSG00000136997 A8MYZ6 increases binding of P41235 to ENSG00000136997 hdac3-myc 1388740 n/a 1388746 unspecified role unspecified role bait bait n/a 1388744 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5f, 5g anti-FOXO6 siRNA According to the figure legend (5g), cells are transfected with siRNA targeting HNF4; however, both the text and figure clearly indicate that cells are transfected with siRNA targeting FOXO6. Overexpression of FOXO6 decreased binding of HDAC3 to c-Myc promoter DNA; however, the origin of the FOXO6 expression construct could not be determined. A8MYZ6 decreases binding of O15379 to ENSG00000136997 foxo6-hnf4a 1388741 n/a FOXO6 1388743 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a HNF4 1388745 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5a homomint mint hnf4a-foxo6 1388741 foxo6 FOXO6 1388743 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level hnf4a_human HNF4 1388745 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5b homomint mint hnf4a-myc-1 1388742 n/a 1388744 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1388745 unspecified role unspecified role bait bait association association false false false Fig. 5i More c-Myc promoter DNA co-precipitated with anti-HNF4 antibody from gastric cancer tissue cells compared to normal gastric tissue cells.