IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ martincic-1997-2 Isolation and characterization of a dual prenylated Rab and VAMP2 receptor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Martincic I., Peralta ME., Ngsee JK. Synapse - Interactions of proteins with an established role in the presynapse. The organism of origin of Vamp proteins cannot be deciphered from the publication, however, the rat and human proteins are very similar hence the organism of the protein assumed to be rat. Source of Rab3A inferred from other work by the same author ngsee@civich.ottawa.on.ca rat brain cDNA library J. Biol. Chem. (0021-9258) 1997 martincic-1997-1 Isolation and characterization of a dual prenylated Rab and VAMP2 receptor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Martincic I., Peralta ME., Ngsee JK. Synapse - Interactions of proteins with an established role in the presynapse. Source of Rab3A inferred from other work by the same author ngsee@civich.ottawa.on.ca rat brain cDNA library J. Biol. Chem. (0021-9258) 1997 martincic-1997-3 Isolation and characterization of a dual prenylated Rab and VAMP2 receptor. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Martincic I., Peralta ME., Ngsee JK. Synapse - Interactions of proteins with an established role in the presynapse. Source of Rab3A inferred from other work by the same author ngsee@civich.ottawa.on.ca rat brain cDNA library J. Biol. Chem. (0021-9258) 1997 praf1_rat Prenylated Rab acceptor protein 1 Rabac1 Pra1 Praf1 PRA1 family protein 1 protein protein rat Rattus norvegicus (Rat) Rat MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEELQMEPV rab1a_rat Ras-related protein Rab-1A Rab1A Rab1 protein protein rat Rattus norvegicus (Rat) Rat MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC rab3a_rat Ras-related protein Rab-3A Rab3a protein protein rat Rattus norvegicus (Rat) Rat MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST vamp2-vamp1_protein fusion protein between Vamp2 1-31 and Vamp1 34-118 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYIFT An amino acid sequence which is not represented in UniProt stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG vamp1_rat Vesicle-associated membrane protein 1 Vamp1 Syb1 Synaptobrevin-1 protein protein rat Rattus norvegicus (Rat) Rat MSAPAQPPAEGTEGAAPGGGPPGPPPNTTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYIFT rab3i_rat Rab-3A-interacting protein Rab3ip Rabin3 Rabin-3 SSX2-interacting protein Rabin8 protein protein rat Rattus norvegicus (Rat) Rat MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCSATIQANALNLSDLPTQPVYSSPRHLNCAEISNISIHVPEPASSVASEVAAGLTRFTSRKDSCNAEREFLQGATVTEASAGNDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANVKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLAAGKTPFKRGHTRNKSTSSAMSGSHQDFSAIQPIVKDCREADLSLYNEFRSWKDEPTMDRTCPFLDKIYQEDIFPCLTFAKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKPCKHRIKLGDSSSYYYISPVCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL rabac1-rab1 773781 n/a 773784 unspecified role unspecified role unspecified role unspecified role n/a 773785 unspecified role unspecified role unspecified role unspecified role Q6NYB7:p.Cys204_Cys205del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4 rabac1-rab3a-1 773781 n/a 773786 unspecified role unspecified role bait bait P63012:p.Cys218_Cys220del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n/a 773784 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4, 5, 6 When the carboxyl-terminal CXC of Rab3A was mutated to CVLL and CVLS interaction was observed with Praf1. This indicates that PRA1 is capable of recognizing Rab with a mono-GG group and that interaction is not limited to GG-modified Rab but also includes farnesylated Rab. rabac1-vamp2 773781 n/a 773787 unspecified role unspecified role unspecified role unspecified role tmd required to bind necessary binding region required to bind range range range range false n/a 773784 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5, 6 rabac1-vamp2_vamp1 773781 n/a 773788 unspecified role unspecified role unspecified role unspecified role n/a 773784 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false 5 syntaxin1a-vamp2 773781 n/a 773789 unspecified role unspecified role unspecified role unspecified role n/a 773787 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false 5 syntaxin1a-vamp1 773781 n/a 773790 unspecified role unspecified role unspecified role unspecified role n/a 773789 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false 5 rabac1-rab3a 773782 n/a 773786 unspecified role unspecified role bait bait P63012:p.Gln81Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 773784 unspecified role unspecified role prey prey physical association physical association false false false rain_3-rab3a 773782 n/a 773786 unspecified role unspecified role bait bait P63012:p.Gln81Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 773791 unspecified role unspecified role prey prey physical association physical association false false false rabac1-vamp2-1 773783 n/a 773784 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 773787 unspecified role unspecified role bait bait tmd required to bind necessary binding region required to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 7,8 The C-terminally truncated form of Rabac1 bound 20 times lesser to Vamp2 Coordinates of the transmembrane domain has not been given in the text, but instead inferred from the UniProtKB entry