IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pooley-2008-7 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast fluorescence fluorescence technology fluorescence immunostaining immunostaining Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-2 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence fluorescence technology fluorescence immunostaining immunostaining Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-6 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-1 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-3 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-4 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast confocal microscopy confocal microscopy immunostaining immunostaining Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-5 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent confocal microscopy confocal microscopy immunostaining immunostaining Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation pooley-2008-8 Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pooley RD., Moynihan KL., Soukoulis V., Reddy S., Francis R., Lo C., Ma LJ., Bader DM. Synapse - Interactions of proteins with an established role in the presynapse. david.bader@vanderbilt.edu J. Cell. Sci. (0021-9533) 2008 Only protein-protein interactions imex curation q155p7_mouse Cenpf Lek1 protein protein mouse Mus musculus Mouse MSWALEEWKEGLPSRALQKIQELEGQLEKLKKEKQQRQFQLDSLEAALQKQKQKVEDGKTEGADLKRENQRLMEICEHLEKSRQKLSHELQVKESQVNLQESQLSSCKKQIEKLEQELKRCKSEFERSQQVAQSADVSLNPCSTPQKLFATPLTPSSTYEDLKEKYNKEVEERKRLEEEVKALHAKKVSLPVSQATMNHRDIARHQASSSVFPWQQENTPSRLSSDALKTPLRRDGSAAHFLGEEVSPNKSSMKTGRGDCSSLPGEPHSAQLLHQAKAQNQDLKSKMTELELRLQGQEKEMRSQVNKCQDLQLQLEKTKVELIEKERILNKTRDEVVRSTAQYDQAAAKCTTLEQKLKTLTEELSCHRQNAESAKRSLEQRIKEKEKELQEELSRQHQSFQALDSEYTQMKTRLTQELQQVKHLHSTLQLELEKVTSVKQQLERNLEEIRLKLSRAEQALQASQVAENELRRSSEEMKKENSLIRSQSEQRTREVCHLEEELGKVKVSLSKSQNFAEEMKAKNTSQEIMLRDLQEKLNQQENSLTLEKLKLALADLERQRNCSQDLLKKREHHIDQLNNKLNKIEKEFETLLSALELKKKECEELKEEKNQISFWKIDSEKLINQIESEKEILLGKINHLETSLKTQQVSPDSNERIRTLEMERENFTVEIKNLQSMLDSKMVEIKTQKQAYLELQQKSESSDQKHQKEIENMCLKANKLTGQVESLECKLQLLSSEVVTKDQQYQDLRMEYETLRDLLKSRGSSLVTNEDNQRSSEDNQRSSEDNQRGSLAFEQQPAVSDSFANVMGRKGSINSERSDCSVDGGRSPEHIAILQNRVTSLESSLESQNQMNSDLQMRCEELLQIKGEVEENLSKAEQIHQNFVAETNQCISKLQEDAAVHQNIVAETLATLESKEKELQLLKEKLEAQQTEVQKLNKNNCLLEGTLKELQLLSDTLSSEKKEMNSIISLSKKNIEELTQANEALKEVNEALEQEKMNLLQKHEKITSCIAEQERSIAELSDQYKQERLQLLQRCEETEAVLEDLRGNYKTAQENNAKLECMLSECTALCENRKNELEQLKETFAKEQQEFLTKLAFAEEQNRKLMLELEIEQQTVRSEITNTNKHSMSATDGLRQECLTLNEEQNEQQNEVSNLTHENEQLMELTQTKHDSYLAVEPVENSVKATEDEIGKSSSQYQMDIDTKDISLDSYKAQLVHLEALVRILEVQLDQSEEENKKLHLELQTIREELETKSSQDPQSQARTGLKDCDTAEEKYVSMLQELSASQNENAHLQCSLQTAVNKLNELGKMCDVLRVEKLQLESELNDSRTECITATSQMTAEVEKLVSEMKMLNHESALSQNELMKDTSGGEFHDKANHSSVFLTPLDSSNFCEQMTLSSKEVRVHFAELQEKFSCLQSEHKILHDQHCEVSSKMSALRSYVDTLKAENSALSMSLRTLQGDLVKEGEPAAEGGHGLPLSFCGADSPSLTNFGETSFYKDVLEQTGDTCHLSLEGNASANSCDLDEEFSSSLEEETLTEKESPPAPGRTVEGLEVLCQVYLQSLKNLEEKTESQRIMKNKEIEELEQLLSSERKELSCLRKQYLSEKEQWQQKLTSVTLEMESKLAEEKQQTKTLSLELEVARLQLQELDLSSRSLLGTDLESVVRCQNDNYDIKESEVYISETTEKTPKQDTDQTCDKDIQQDLGLETSVTESETTRLTGEGCEEQPPKTNCEAPAEDKTQDCSECISELCSSSNVLVPMDVLEDQGSIQNLQLQKDTLNENLRLLPEVEDWDKKVESLLNEIMEADSKLSLQEVQLKMKIATCIQLEKIVKDLRKEKADLSEKLESLPCNQEVCLRVERSEEDLGFNLDMGANELLSKSTKDNATNTEDNYKEKFLDMERELTRIKSEKANIEHHILSVETNLEVVQAEKLCLERDTESKQKVIIDLKEELFTVISERNRLREELDNVSKESKALDQMSKKMKEKIEELESHQRESLRHIGAVESEVKDKADLIQTLSFNVGELTKDKAHLQEQLQNLQNDSQELSLAIGELEIQIGQLNKEKESLVKESQNFQIKLTESECEKQTISKALEVALKEKGEFAVQLSSAQEEVHQLRRGIEKLSVRIEADEKKHLSAVAKLKESQRESDSLKDTVETLERELERSEENQELAILDSENLKAEVETLKAQKDEMTKSLRIFELDLVTVRTERENLAKQLQEKQSRVSELDERCSSLRRLLEEKEQARVQMEEDSKSAMLMLQMQLKELREEVAALCNDQETLKAQEQSLDQPGEEVHHLKSSIRKLKVHIDADEKKHQNILEQLKESKHHADLLKDRVENLEQELILSEKNMIFQAEKSKAEIQTLKSEIQRMAQNLQDLQLELISTRSENENLIKELKKEQERVSDLETINPSIENLLKDKEQEKVQMKEEAKITVEMLQTQLKELNETVVSLCNDQEVSKTKEQNLGSQVQTLELEKAQLLQDLGEAKNKYIIFQSSVNALTQEVEAGKQKLEKGEKEIRTLKEQLKSQEQLVCKLAQVEGEQELWQKQKLELRNVTMALEQKVQVLQSENNTLQSTYEALQNSHKSLESELGLIKLEKVALVERVSTISGKEAELQRELRDMLQKTTQLSEDYNKEKNRLTEEVEVLREELQNTKAAHLKSVNQLEKELQRAQGKIKLMLKSCRQLEGEKEMLQKELSQLEAAQQQRAGSLVDSNVDEVMTENKALKETLEEKVKEADKYLDKYCSLLISHEELEKAKEILEIEVARLKSRQSRQDLQSSPLLNSSIPGPSPNTSVSEMKSASGQNKASGKRQRSSGVWEHGKRAAPSTAETFSKKSRKSDSKSTRPAEHEQETEFEPEGLPEVVKKGFADIPTGKTSPYILRRTTMATRTSPRFATQKLVGSSPSLGKENVVESSKPTAGGSRSQKVKVVQESSADSHTAFQELPAKSLTASNIPGRNSTESPREGLRAKRAYPASSPAAGPDPTNNENCRVQ snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG stx4_mouse Syntaxin-4 Stx4 Stx4a protein protein mouse Mus musculus Mouse MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST goga1_mouse Golgin subfamily A member 1 Golga1 Golgin-97 protein protein mouse Mus musculus Mouse MFAKLKKKIAEETAVAQRPGGTTRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQASRAKMAEGLALALARKDQEWSEKMEQLEKDKRFLTSQLQEVKNQSLSLFQKRDEIDELEGFQQQEISKVKHMLLKKEECLGKMEQELDARTRELNRTQEELVTSNQLSSDLNERLEELQRHCSTLEEQRDHLTASKAGAEHKIVVLEQKEQELQAIIQQHSIDLQKVTAETQEKEKVITHLQEKVIFLEKRLEQNLSGEDHVQELLKEKTVAEQNLEDTRQQLLAARNSHTKALYLLETRVKDLERSLQAAEEQLSQSRNVVADQEAQIQKLITTNQENSLSQQQVLALEQHCRERIHALEAQIEALEQTRVADQIASEQGMLQLQQENVALKESRNECEHSLQHHQLELKKLKDEWSQREIVSVAMAQALEEVRKQREEFQQQATELTAIIEEKNQSLCEKDEALLQKEQELRQLEKGHSSALLQMHKLQRELEALKTCKAQEAMPATTGEDCLPLQGQEPLVISKAMQNSEYELPAAEGTPNGEVGASDLKQLQKEKQDLEQQLIEKNKIMKQMQQRMLELKKTLQKELKIRPDSELFEVREKTGPEIPNMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPTPKGSIRPSISNPRIPWS goga1_cerae_protein Golgin subfamily A member 1 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt similar to GOGA1_HUMAN (AC: Q92805) vamp2_cerae_protein Vesicle-associated membrane protein 2 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to VAMP2_HUMAN (P63027). No sequence available cenpf-snap25-9 Colocalization of cenpf and snap25 in the cytoplasm and perinuclear region of c2c12 cells 799767 n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 799776 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 4B cenpf-stx4-7 Colocalization of cenpf and stx4 in the cytoplasm and perinuclear region of c2c12 cells 799767 n/a 799777 unspecified role unspecified role neutral component neutral component n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig 4A cenpf-vamp2 Colocalization of cenpf and vamp2 in the cytoplasm and perinuclear region of c2c12 cells. 799767 n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 799778 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 4D. cenpf-golgin97 Colocalization of cenpf and golgin-97 in the cytoplasm and perinuclear region of c2c12 cells. 799767 n/a 799779 unspecified role unspecified role neutral component neutral component n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig 4C. cenpf-stx4-2 Colocalization showing in-vivo interaction between murine cenpf and stx4 799768 n/a 799777 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig 2 A-E. cenpf-stx4golgin Colocalization showing in-vivo interaction between murine cenpf, stx4 and golgin. 799768 n/a 799780 unspecified role unspecified role neutral component neutral component n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 799777 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 5A. cenpf-stx4vmp2 Colocalization showing in-vivo interaction between murine cenpf, stx4 and vamp2. 799768 n/a 799777 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799775 unspecified role unspecified role neutral component neutral component n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 799781 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 5B. cenpf-stx4-6 CoIP showing in-vivo interaction between murine cenpf and stx4 799769 n/a 799777 unspecified role unspecified role prey prey n/a 799775 unspecified role unspecified role bait bait physical association physical association false false false Fig 3D. cenpf-snap25-2 CoIP showing in-vivo interaction between murine cenpf and snap25 799769 n/a 799776 unspecified role unspecified role prey prey n/a 799775 unspecified role unspecified role bait bait physical association physical association false false false Fig 3D. cenpf-stx4-1 Y2H showing interaction between murine cenpf and stx4 799770 n/a 799775 unspecified role unspecified role bait bait n-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 799777 unspecified role unspecified role prey prey physical association physical association false false false Fig 1A. cenpf-stx4-3 CoIP showing in-vivo interaction between murine cenpf and stx4 799771 n/a 799775 unspecified role unspecified role bait bait n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799777 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2 F. cenpf-stx4-4 Colocalization showing in-vivo interaction between murine cenpf and stx4 799772 n/a 799777 unspecified role unspecified role neutral component neutral component n/a 799775 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 3A. cenpf-stx4-5 Colocalization showing in-vivo interaction between murine cenpf and stx4 799773 n/a 799777 unspecified role unspecified role neutral component neutral component n/a 799775 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 3B and 3C. Differentiated 3T3-L1 adipocytes demonstrated a high degree of endogenous CENPF and syntaxin 4 colocalization at the perinuclear region of the cytoplasm. cenpf-stx4-8 Y2H showing interaction between murine cenpf and stx4 799774 n/a 799777 unspecified role unspecified role prey prey n/a 799775 unspecified role unspecified role bait bait n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1A.