IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yao-2007-1 SCRAPPER-dependent ubiquitination of active zone protein RIM1 regulates synaptic vesicle release. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yao I., Takagi H., Ageta H., Kahyo T., Sato S., Hatanaka K., Fukuda Y., Chiba T., Morone N., Yuasa S., Inokuchi K., Ohtsuka T., Macgregor GR., Tanaka K., Setou M. Synapse - Interactions of proteins with an established role in the presynapse. Authors have identified a new isoform of Fbxll20 - this is currently being added to the existing UniProt entry after which the entry will be remapped to a more granular protein description. setou@nips.ac.jp Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation yao-2007-3 SCRAPPER-dependent ubiquitination of active zone protein RIM1 regulates synaptic vesicle release. mouse-brain-hippocampus Mus musculus brain_hippocampus brain hippocampus fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Yao I., Takagi H., Ageta H., Kahyo T., Sato S., Hatanaka K., Fukuda Y., Chiba T., Morone N., Yuasa S., Inokuchi K., Ohtsuka T., Macgregor GR., Tanaka K., Setou M. Synapse - Interactions of proteins with an established role in the presynapse. Authors have identified a new isoform of Fbxll20 - this is currently being added to the existing UniProt entry after which the entry will be remapped to a more granular protein description. setou@nips.ac.jp Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation yao-2007-4 SCRAPPER-dependent ubiquitination of active zone protein RIM1 regulates synaptic vesicle release. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Yao I., Takagi H., Ageta H., Kahyo T., Sato S., Hatanaka K., Fukuda Y., Chiba T., Morone N., Yuasa S., Inokuchi K., Ohtsuka T., Macgregor GR., Tanaka K., Setou M. Synapse - Interactions of proteins with an established role in the presynapse. Authors have identified a new isoform of Fbxll20 - this is currently being added to the existing UniProt entry after which the entry will be remapped to a more granular protein description. setou@nips.ac.jp Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation yao-2007-2 SCRAPPER-dependent ubiquitination of active zone protein RIM1 regulates synaptic vesicle release. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yao I., Takagi H., Ageta H., Kahyo T., Sato S., Hatanaka K., Fukuda Y., Chiba T., Morone N., Yuasa S., Inokuchi K., Ohtsuka T., Macgregor GR., Tanaka K., Setou M. Synapse - Interactions of proteins with an established role in the presynapse. Authors have identified a new isoform of Fbxll20 - this is currently being added to the existing UniProt entry after which the entry will be remapped to a more granular protein description. setou@nips.ac.jp Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cul1_mouse Cullin-1 Cul1 protein protein mouse Mus musculus Mouse MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 3E1F8B63C6E498F4 fxl20_mouse F-box/LRR-repeat protein 20 Fbxl20 Fbl2 F-box and leucine-rich repeat protein 20 F-box/LRR-repeat protein 2-like protein protein mouse Mus musculus Mouse MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL skp1_mouse S-phase kinase-associated protein 1 Skp1 Skp1a S-phase kinase-associated protein 1A Cyclin-A/CDK2-associated protein p19 p19skp1 p19A protein protein mouse Mus musculus Mouse MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK rims1_mouse Regulating synaptic membrane exocytosis protein 1 Rab-3-interacting molecule 1 Rab-3-interacting protein 1 Rims1 Rab3ip1 Rim1 Kiaa0340 protein protein mouse Mus musculus Mouse MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPDRNWRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAVSSQDTASHGAPLDRNKGAEPSQQALGPEQKQASRSRSEPPRERKKAPGLSEQNGKGGQKSERKRVPKSVVQPGEGTADERERKERRETRRLEKGRSQDYPDRLEKREDGRVAEDEKQRKEEEGVSTPEYTSCEDVELESESVSEKGDLDYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQRSQRISDSDISDYEVDDGIGVVPPVGYRASARESKATTLTVPEQQRTTHHRSRSVSPHRGDDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSLADHRSRHAESQYSSEPDSELLMLPRAKRGRSAECLHMTSELQPSLDRARSASTNCLRPDTSLHSPERERGRWSPSLARRRPASPRIQIQHASPENDRHSRKSERSSIQKQSRKGTASDADRVLPPCLSRRGYAIPRATDQPVIRGKHTTRSRSSEHSSIRTLCSMHHLAPGGSAPPSPLLTRTHRQGSPTQSPPADTSFGSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDHEQYSKYNIHKDQYRSCDNASAKSSDSDVSDVSAISRASSTSRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRAIIKSTSVSGEIYTLEHNDGSQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRVGPDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSSLESSSGPPCIRS syph_mouse Synaptophysin Major synaptic vesicle protein p38 BM89 antigen Syp protein protein mouse Mus musculus Mouse MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGGYGPQGDYGQQGYGQQGAPTSFSNQM ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC fbxl20-skp1-1 Interaction between Skp1, FBXL20 and Cullin-1 identified by coimmunoprecipitation 677280 N/A 677284 unspecified role unspecified role prey prey N/A 677285 unspecified role unspecified role bait bait N/A 677286 unspecified role unspecified role prey prey association association false false false Figure 2A fbxl20-rims1-1 Interaction between FBXL20 and RIMS1 identified by coimmunoprecipitation 677280 N/A 677285 unspecified role unspecified role bait bait N/A 677287 unspecified role unspecified role prey prey physical association physical association false false false Figure 2C fxl20-rps27a-2 Interaction of ubiquitin with FBXL20 identified by coimmunoprecipitation 677281 N/A 677288 unspecified role unspecified role neutral component neutral component N/A 677285 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 1F fbxl20-rims1-3 Interaction between FBXL20 and RIMS1 identified by colocalisation 677281 N/A 677285 unspecified role unspecified role neutral component neutral component N/A 677287 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 2D fbxl20-rims1-2 Interaction between FBXL20 and RIMS1 identified by pulldown 677282 N/A 677285 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 677287 unspecified role unspecified role prey prey c2 region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 2E fbxl20-rims1-4 Interaction between FBXL20 and RIMS1 identified by pulldown 677282 N/A 677287 unspecified role unspecified role bait bait c2 region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 677285 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 2E fxl20-rps27a-1 Interaction of ubiquitin with FBXL20 identified by coimmunoprecipitation 677283 N/A 677285 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 677289 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2B