UniProt UniProt http://www.uniprot.org liang-2007-1 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-2 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-3 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-4 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-5 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag fluorescence tag visualisation by fluorescence tag fluorescence Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-6 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-7 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation liang-2007-8 Interaction of the mu-opioid receptor with synaptophysin influences receptor trafficking and signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Liang Y.J., Wu D.F., Yang L.Q., Hollt V., Koch T. Synapse - Interactions of proteins with an established role in the presynapse. HA-MOPr was detected by immunostaining. thomas.koch@medizin.uni-magdeburg.de rat brain cDNA library (Clontech). Mol. Pharmacol. (0026-895X) 2007 mimix curation syph_rat Synaptophysin Major synaptic vesicle protein p38 Syp protein protein rat Rattus norvegicus (Rat) Rat MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM oprm_rat Mu-type opioid receptor Oprm1 Ror-b Opioid receptor B protein protein rat Rattus norvegicus (Rat) Rat MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP oprm1-syp 1252013 n/a 1252021 unspecified role unspecified role prey prey n/a 1252022 unspecified role unspecified role bait bait physical association physical association false false false no figure oprm1-syp-1 1252014 n/a 1252022 unspecified role unspecified role bait bait n/a 1252021 unspecified role unspecified role prey prey physical association physical association false false false no figure oprm1-syp-2 1252015 n/a 1252022 unspecified role unspecified role bait bait n/a 1252021 unspecified role unspecified role prey prey physical association physical association false false false 1A oprm1-syp-3 1252016 n/a 1252022 unspecified role unspecified role bait bait n/a 1252021 unspecified role unspecified role prey prey physical association physical association false false false 1B oprm1-syp-7 1252017 n/a 1252021 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n/a 1252022 unspecified role unspecified role fluorescence donor fluorescence donor proximity proximity close-contact colocalization neighbourhood interaction false false false 1c oprm1-syp-5 1252018 n/a 1252021 unspecified role unspecified role neutral component neutral component n/a 1252022 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2c, 2d. oprm1-syp-6 1252019 n/a 1252021 unspecified role unspecified role neutral component neutral component n/a 1252022 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2e oprm1-syp-8 1252020 n/a 1252021 unspecified role unspecified role neutral component neutral component n/a 1252022 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4a