MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint he-2006b-3 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation he-2006b-1 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation he-2006b-2 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation q14103-4 Heterogeneous nuclear ribonucleoprotein D0 p37 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 263. Contains a N6-acetyllysine at position 273. 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS q14103-3 Heterogeneous nuclear ribonucleoprotein D0 p40 Dx7 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 282. Contains a N6-acetyllysine at position 292. 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN sfn-hnrpd 508302 N/A 508305 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 508306 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. sfn-hnrpd-1 508302 N/A 508305 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508306 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 4 AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation p37 AUF1 was used in the experiment. sfn-hnrpd-2 508302 N/A 508306 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508307 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. sfn-hnrpd-3 508302 N/A 508305 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 508306 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2A AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-sfn-2 508302 N/A 508306 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 508305 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-ywhah-3 508302 N/A 508308 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 508305 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-sfn-3 508302 N/A 508305 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508306 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 direct interaction direct interaction false false false 1C AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-sfn 508303 N/A 508305 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508306 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 direct interaction direct interaction false false false 1A AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation the His-p37 recovery assay suggested that only the sigma isoform, but not the g or b/z isoforms, of 14-3-3 binds to p37 AUF1. hnrpd-sfn-1 508304 N/A 508305 unspecified role unspecified role prey prey N/A 508306 unspecified role unspecified role bait bait physical association physical association false false false 3A AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation there was little detectable interaction with the other three isoforms of AUF1, p40, p42 or p45 (Figure 3A).