IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gao-2006a-1 A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Adult human brain cDNA Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation gao-2006a-2 A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation Adult human brain cDNA gao-2006a-3 A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation Adult human brain cDNA gao-2006a-4 A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation Adult human brain cDNA gao-2006a-5 A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation Adult human brain cDNA 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN cdk14_human Cyclin-dependent kinase 14 CDK14 KIAA0834 PFTK1 Serine/threonine-protein kinase PFTAIRE-1 Cell division protein kinase 14 protein protein human Homo sapiens Human MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN pftk1-ywhab-1 Interaction between PFKT1 and YWHAB (14-3-3 beta) identified by Y2H 594834 N/A 594839 unspecified role unspecified role prey prey N/A 594840 unspecified role unspecified role bait bait physical association physical association false false false pftk1-ywhae-1 Interaction between PFKT1 and YWHAE (14-3-3 epsilon) identified by Y2H 594834 N/A 594841 unspecified role unspecified role prey prey N/A 594840 unspecified role unspecified role bait bait physical association physical association false false false pftk1-ywhah-1 Interaction between PFKT1 and YWHAH (14-3-3 eta) identified by Y2H 594834 N/A 594840 unspecified role unspecified role bait bait N/A 594842 unspecified role unspecified role prey prey physical association physical association false false false pftk1-ywhaq-1 Interaction between PFKT1 and YWHAQ (14-3-3 theta) identified by Y2H 594834 N/A 594840 unspecified role unspecified role bait bait N/A 594843 unspecified role unspecified role prey prey physical association physical association false false false pftk1-ywhab-2 Interaction between PFKT1 and YWHAB (14-3-3 beta) identified by Y2H 594835 N/A 594839 unspecified role unspecified role prey prey N/A 594840 unspecified role unspecified role bait bait O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1A, 1B, 3A, 4A pftk1-ywhae-2 Interaction between PFKT1 and YWHAE (14-3-3 epsilon) identified by Y2H 594835 N/A 594840 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 594841 unspecified role unspecified role prey prey physical association physical association false false false 1A, 1B, 3A, 4A pftk1-ywhah-2 Interaction between PFKT1 and YWHAH (14-3-3 eta) identified by Y2H 594835 N/A 594842 unspecified role unspecified role prey prey N/A 594840 unspecified role unspecified role bait bait O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A, 1B, 3A, 4A pftk1-ywhaq-2 Interaction between PFKT1 and YWHAQ (14-3-3 theta) identified by Y2H 594835 N/A 594843 unspecified role unspecified role prey prey N/A 594840 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A, 1B, 3A, 4A pftk1-ywhab-3 Interaction between PFKT1 and YWHAB (14-3-3 beta) identified by coimmunoprecipitation 594836 N/A 594839 unspecified role unspecified role prey prey region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 594840 unspecified role unspecified role bait bait lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C pftk1-ywhae-3 Interaction between PFKT1 and YWHAE (14-3-3 epsilon) identified by coimmunoprecipitation 594836 N/A 594841 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 594840 unspecified role unspecified role bait bait lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C pftk1-ywhah-3 Interaction between PFKT1 and YWHAH (14-3-3 eta) identified by coimmunoprecipitation 594836 N/A 594842 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 594840 unspecified role unspecified role bait bait lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C pftk1-ywhaq-3 Interaction between PFKT1 and YWHAQ (14-3-3 theta) identified by coimmunoprecipitation 594836 N/A 594840 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 594843 unspecified role unspecified role prey prey lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C pftk1-ywhab-4 Interaction between PFKT1 and YWHAB (14-3-3 beta) identified by coimmunoprecipitation 594837 N/A 594840 unspecified role unspecified role bait bait N/A 594839 unspecified role unspecified role prey prey physical association physical association false false false 1D pftk1-ywhab-5 Interaction between PFKT1 and YWHAB (14-3-3 beta) identified by coimmunoprecipitation 594838 N/A 594839 unspecified role unspecified role prey prey N/A 594840 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3C