IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pellinen-2006-3 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-saos-2 Homo sapiens SAOS-2 cell line established from primary osteogenic sarcoma saos-2 Homo sapiens SAOS-2 cell line established from primary osteogenic sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-4 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-6 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. The MDA-MB-231 cells were surface labeled with cleavable biotin and lysed immediately or allowed to internalize cell surface proteins for 15 min. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-10 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-1 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-2 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-5 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-7 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. GFP-Rab21 is detected with an anti-tag western blot additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-8 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation pellinen-2006-9 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 Only protein-protein interactions imex curation rab21_mouse Ras-related protein Rab-21 Rab21 Rab-12 protein protein mouse Mus musculus Mouse MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG integrin-a2-1_human chimeric integrin containing the extracellular domain of alpha2-integrin fused to the C terminal domain of alpha1 protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK integrin-a2-5_human chimeric integrin containing the extracellular domain of alpha2-integrin fused to the C terminal domain of alpha5 protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt ita2_human Integrin alpha-2 Platelet membrane glycoprotein Ia Collagen receptor VLA-2 subunit alpha CD49 antigen-like family member B ITGA2 CD49B protein protein human Homo sapiens Human MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPKQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS rab21_human Ras-related protein Rab-21 RAB21 KIAA0118 protein protein human Homo sapiens Human MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG rab5a_human Ras-related protein Rab-5A RAB5A RAB5 protein protein human Homo sapiens Human MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN ita11_human Integrin alpha-11 ITGA11 MSTP018 protein protein human Homo sapiens Human MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGAPLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKNHGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYFGSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNARFGSSIASVRDLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFFRAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFTRSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLLKLRDFLTDEANTSCNIWGNSTEYRPTPVEEDLRRAPQLNHSNSDVVSINCNIRLVPNQEINFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE itga2_a1-rab21-1 physical association of rab21 with the chimeric integrin alpha2-alpha1 894400 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 894411 unspecified role unspecified role bait bait physical association physical association false false false fig. 1. B specific antibody against integrin alpha2 for the immunoprecipitation EBI-2624041; P35282 transfection itgb1-rab21-1 physical association of itgb1 with Rab21 894400 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 894412 unspecified role unspecified role bait bait physical association physical association false false false fig. 1. B specific antibody against integrin beta1 for the immunoprecipitation P35282 transfection itga2_a5-rab21-1 physical association of rab21 with the chimeric integrin alpha2-alpha5 894400 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 894413 unspecified role unspecified role bait bait physical association physical association false false false fig. 1. B specific antibody against integrin alpha2 for the immunoprecipitation EBI-2624056; P35282 transfection itgb1-rab21-2 physical association of itgb1 with Rab21 894401 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35282:p.Thr31Asn Rab21GDP mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false range C-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 894412 unspecified role unspecified role bait bait physical association physical association false false false fig. 1. C and supplementary table S1 specific antibody against integrin beta1 for the immunoprecipitation P35282 transfection The mutant Rab21c-del which is composed of the residues 1 to 144 of the full length Rab21 is weakly interacting with interactin beta. The residues 95 to 144 seem to be sufficient to bind. itga2-rab21-3 physical association of itga2 with Rab21 894401 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P35282:p.Thr31Asn Rab21GDP mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false range C-terminal sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 894414 unspecified role unspecified role bait bait physical association physical association false false false Supplementary table S1 specific antibody against integrin alpha2 for the immunoprecipitation P35282 transfection The mutant Rab21c-del which is composed of the residues 1 to 144 of the full length Rab21 is weakly interacting with interactin alpha. The residues 95 to 144 seem to be sufficient to bind. rab21-itgb1-3 physical association of Rab21 with itgb1 894402 n/a 894415 unspecified role unspecified role bait bait n/a 894412 unspecified role unspecified role prey prey physical association physical association false false false fig. 1. F and Fig. 3. A specific antibody against Rab21 for the immunoprecipitation and specific antibody against integrin beta1 for the western blot beta integrin associate with Rab21 mainly after internalization rab5-itgb1-1 physical association of Rab5 with itgb1 894402 n/a 894416 unspecified role unspecified role bait bait n/a 894412 unspecified role unspecified role prey prey physical association physical association false false false fig. 1. F and Fig. 3. A specific antibody against Rab5 for the immunoprecipitation and specific antibody against integrin beta1 for the western blot beta integrin associate with Rab5 mainly after internalization itga11-rab21-1 physical association of itga11 with rab21 894403 n/a 894410 unspecified role unspecified role prey prey c-terminus COOH terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 894417 unspecified role unspecified role bait bait c-terminus C-terminal construct sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 894457 894455 physical association physical association false false false fig. 1. D itga2-rab21-7 physical association of itga2 with rab21 894403 n/a 894410 unspecified role unspecified role prey prey c-terminus COOH terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 894414 unspecified role unspecified role bait bait c-terminus cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P17301:p.Lys1162Pro lys1162pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P17301:p.Lys1160_Arg1161delinsAlaAla lys1160ala_arg1161ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P17301:p.[Phe1159_Lys1160delinsAlaAla;Lys1162Ala] phe1159ala_lys1160ala_lys1162ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false undefined mutation lys1160ala_arg1161ala_glu1164ala_lys1165ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 894462 894460 physical association physical association false false false fig. 1. D itga2-rab21-1 physical association of itga2 with rab21 894404 n/a 894410 unspecified role unspecified role prey prey n/a 894414 unspecified role unspecified role bait bait c-terminus cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false itga2-rab21-2 physical association of rab21 with itga2 894405 n/a 894410 unspecified role unspecified role bait bait region GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 894414 unspecified role unspecified role prey prey physical association physical association false false false fig. 1. A specific antibody against integrin alpha2 for the western blot The authors said that GFP-tagged Rab21 coprecipitated with alpa2 beta1-integrin but they used only antibodies against alpha2-integrin for the western blot P35282 transfection itga2-rab21-4 physical association of itga2 with Rab21 894406 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 894414 unspecified role unspecified role bait bait region GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P17301:p.Lys1160_Arg1161delinsAlaAla lys1160ala_arg1161ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P17301:p.Lys1162Pro lys1162pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P17301:p.[Lys1160_Arg1161delinsAlaAla;Glu1164_Lys1165delinsAlaAla] lys1160ala_arg1161ala_glu1164ala_lys1165ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false fig. 1. E P17301; P35282 transfection rab21-itga2-5 physical association of Rab21 with itga2 894407 n/a 894410 unspecified role unspecified role neutral component neutral component region GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P35282:p.Thr31Asn Rab21GDP mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 894414 unspecified role unspecified role neutral component neutral component physical association physical association false false false fig. 3. D P35282 transfection GFP-Rab21 cofractionned with alpha 2 integrin in fractions 3 to 9. The mutant gln76leu-Rab21 cofractionned with alpha 2 integrin in fractions 5 to 11 (denser fractions) and thr31asn-Rab21 cofractionned with alpha 2 integrin in fractions 4 to 8. itgb1-rab21-4 physical association of itgb1 with Rab21 894408 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 894412 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5. A specific antibody against integrin beta for the immunoprecipitation and P35282 transfection itga2-rab21-6 physical association of itga2 with rab21 894409 n/a 894410 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 894414 unspecified role unspecified role bait bait n-terminal GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig. 5. A P35282; P17301 transfection