IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pastorino-2006-1 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Neuroglioma cell line H4 immunostained followed by confocal microscopy Following corespondence with the author (KPL) species origin of sequence for GST-Pin1 and HA-APP was confirmed to be human. klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pastorino-2006-5 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster light microscopy light microscopy antibody detection identification by antibody antibody detection Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Neuroglioma cell line H4 immunostained followed by confocal microscopy klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pastorino-2006-7 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. human-h4 Homo sapiens neurogioma cell line h4 Human neuroglioma light microscopy light microscopy antibody detection identification by antibody antibody detection Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Neuroglioma cell line H4 immunostained followed by confocal microscopy klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pastorino-2006-6 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Amino acid numbering in the publication is according to the APP695 isoform and thus differs from that shown in the interaction. Neuroglioma cell line H4 immunostained followed by confocal microscopy Following corespondence with the author (KPL) species origin of sequence for GST-Pin1 and APP were confirmed to be human. klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pastorino-2006-4 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Neuroglioma cell line H4 immunostained followed by confocal microscopy Following corespondence with the author (KPL) species origin of sequence for GST-Pin1 and HA-APP was confirmed to be human. klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pastorino-2006-3 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Neuroglioma cell line H4 immunostained followed by confocal microscopy Following corespondence with the author (KPL) species origin of sequence for GST-Pin1 APP was confirmed to be human. klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pastorino-2006-2 The prolyl isomerase Pin1 regulates amyloid precursor protein processing and amyloid-beta production. mouse-n18 Mouse N18 neuroblstoma cell line n18 Mouse neuroblastome cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pastorino L., Sun A., Lu PJ., Zhou XZ., Balastik M., Finn G., Wulf G., Lim J., Li SH., Li X., Xia W., Nicholson LK., Lu KP. Synapse - Interactions of proteins with an established role in the presynapse. Neuroglioma cell line H4 immunostained followed by confocal microscopy Following corespondence with the author (KPL) species origin of sequence for HA-APP was confirmed to be human. klu@bibmc.harvard.edu Nature (0028-0836) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE p05067-4 Amyloid-beta precursor protein APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI PreA4 695 Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN A major isoform. a4_mouse Amyloid-beta precursor protein App Alzheimer disease amyloid A4 protein homolog ABPP Amyloidogenic glycoprotein Amyloid precursor protein A4 AD1 Alzheimer disease amyloid protein Amyloid-beta (A4) precursor protein Amyloid-beta A4 protein protein protein mouse Mus musculus Mouse MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN p05067-8 Amyloid-beta precursor protein APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI PreA4 751 Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN A major isoform. g3h6f2_crigr Peptidyl-prolyl cis-trans isomerase I79_005909 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MCVRVVWTENSTREGTLGDPRVLTPLSPIIPGVAAVTMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDCRVYYFNHITNASQWERPSGGSSVGGSSKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE a4_human Amyloid-beta precursor protein APP A4 AD1 Alzheimer disease amyloid protein ABPP PreA4 Cerebral vascular amyloid peptide Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN apppeptide APP peptide G734-Q754 peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human GVVEVDAAVTPEERHLSKMQQ An amino acid sequence which is not represented in UniProt p05067-pro_0000000098 Gamma-secretase C-terminal fragment 57 APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human TVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN 714 770 pin1_mouse Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 protein protein mouse Mus musculus Mouse MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCSHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE pin1-aplp1-1 Pin 1 binds to HA-APP in mitotic cells, identified by GST pulldown 854084 n/a 854091 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 854092 unspecified role unspecified role prey prey ha-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P05067-4:p.Thr668Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false Recombinant Glutathione S-transferase (GST)-fusion proteins containing Pin1 were incubated with extracts from N18 cells, that had been transfected with an HA-APP construct and arrested at mitosis or G1/S. Bound proteins were detected by western blot with antibodies to APP. Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure 1 Pin1 failed to bind to T743A APP mutant construct indiciating that the Thr743Pro motif is important for binding. pin1-app Pin 1 binds to native APP in mitotic cells, identified by GST pulldown 854084 n/a 854091 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 854093 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false Recombinant Glutathione S-transferase (GST)-fusion proteins containing Pin1 were incubated with extracts from N18 cells, that had been arrested at mitosis or G1/S. Bound proteins were detected by western blot with antibodies to APP. Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure S1 homer2-pin1 Pin 1 colocalises with APP in CHO cells, identified by immunofluresence. 854085 n/a 854094 unspecified role unspecified role unspecified role unspecified role crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster n/a 854095 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false CHO-APP cells, stably expressing the wild type human APP751 iosform, were immunostained with antibodies for Pin1 and APP. Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure 3a APP polyclonal antibody raised against the C-terminal domain of the protein (Sigma) or mAb against N-terminal APP22C11 (Chemicon) was used. For Pin1, monoclonal or polyclonal antibodies were used. app-pin1 Pin 1 colocalises with APP in H4 cells, identified by immunofluoresence. 854086 n/a 854091 unspecified role unspecified role neutral component neutral component n/a 854096 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure S3 APP polyclonal antibody raised against the C-terminal domain of the protein (Sigma) or mAb against N-terminal APP22C11 (Chemicon) was used. For Pin, monoclonal or polyclonal antibodies were used. apppeptide-pin1 NMR structure of Pin1 catalysed isomerization of APP peptide 854087 n/a 854091 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 854097 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Amino acid numbering in the publication is according to the APP695 isoform and thus differs from that shown in the interaction. NMR used to measure enzyme kinetics of Pin1 catalytic activity. pin1-p01308pro_00000 Pin 1 binds to APP phosphorylated intracellular domain AICD, identified by GST pulldown 854088 n/a 854098 unspecified role unspecified role prey prey 32p labelled 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false thr-743 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 854091 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ww domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Pull down using GST-WW (WW domain of Pin)was also performed with the addition of increasing amounts of a pThr 743- containing APP phosphopeptide. This competed out the purification of the 32P labelled peptide indicating that the WW domain in Pin1 mediates the interaction with APP ACID domain. The AICD domain with T-A mutation at position 743 was inculuded as a control. This product was neither phosphorylated by cyclinB/Cdc2 nor bound by Pin1. Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure 1 and S1 Amino acid numbering in publication refers to numbering for APP 695 variant and thus differs from that shown in the interaction. There are more than one variant of the AICD domain. The description of the use of the CTF(57) sequence was included in supplementary methods. pin1-aplp1-3 Pin 1 binds to phosphorylated APP, identified by GST pulldown 854089 n/a 854091 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 854092 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P05067-4:p.Thr668Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 35S-APP was synthesised and phosphorylated by Xenopus extracts and complexes were pulled down by a Pin1-GST fusion protein. Additional samples were phosphorylated and then desphosphorylated with CIP prior to GST pull down. Pin1-APP binding was not detected in those samples that had been dephorylated. Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure 1 aplp1-pin1-1 Pin 1 binds to APP in mitotic cells, identified by coip 854090 n/a 854099 unspecified role unspecified role prey prey mouse Mus musculus Mouse n/a 854092 unspecified role unspecified role bait bait ha-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P05067-4:p.Thr668Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false N18 cells were transfected with an HA-APP construct and arrested at mitosis or G1/S. Anti-HA monoclonal antibody used to coip complexes binding to APP which were then detected by western blot with antibodies to Pin1. Interaction between APP and Pin1 is strongest in mitotic cells. Detailed methods not contained within publication but sourced from supplementary material and references therein. Figure 1