IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ erickson-2005-2 In cerebrospinal fluid ER chaperones ERp57 and calreticulin bind beta-amyloid. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Erickson RR., Dunning LM., Olson DA., Cohen SJ., Davis AT., Wood WG., Kratzke RA., Holtzman JL. Synapse - Interactions of proteins with an established role in the presynapse. abeta-ERp57(PDIA3) complex was isolated by immunochromatography with antibodies to to ERp57 and abeta bound to CNBr-activated Sepharose. The ERp57 and abeta in the eluates were identified by immunoblotting. holtz003@umn.edu Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease erickson-2005-1 In cerebrospinal fluid ER chaperones ERp57 and calreticulin bind beta-amyloid. human Homo sapiens Human comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Erickson RR., Dunning LM., Olson DA., Cohen SJ., Davis AT., Wood WG., Kratzke RA., Holtzman JL. Synapse - Interactions of proteins with an established role in the presynapse. A number of antibodies for each target are used in the publication, the specific antibodies used for figure 2 are not specified. abeta-ERp57(PDIA3) complex was isolated by immunochromatography with antibodies to to ERp57 and abeta bound to CNBr-activated Sepharose. The ERp57 and abeta in the eluates were identified by immunoblotting. holtz003@umn.edu chicken polyclonal to ERp57 (previously described in Chen, Biochemistry 25 (1996) 5892-5986, rabbit polyclonal to Abeta (R1282, gift from D. Selkow, harvard medical School), anti calreticulin. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease pdia3_human Protein disulfide-isomerase A3 Disulfide isomerase ER-60 Endoplasmic reticulum resident protein 60 58 kDa microsomal protein Endoplasmic reticulum resident protein 57 58 kDa glucose-regulated protein PDIA3 ERP60 GRP58 ERP57 protein protein human Homo sapiens Human MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL a4_human Amyloid-beta precursor protein APP A4 AD1 Alzheimer disease amyloid protein ABPP PreA4 Cerebral vascular amyloid peptide Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN calr_human Calreticulin CRP55 Calregulin HACBP Endoplasmic reticulum resident protein 60 grp60 CALR CRTC protein protein human Homo sapiens Human MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL app-pdia3 abeta antibodies pull down a PDIA3 (ERp57) and abeta complex in cerebrospinal fluid. 854261 n/a 854263 unspecified role unspecified role prey prey n/a 854264 unspecified role unspecified role bait bait physical association physical association false false false Figure 3, channel 3. pdia3-app ERp57 antibodies pull down a PDIA3 (ERp57) and abeta complex in cerebrospinal fluid. 854261 n/a 854264 unspecified role unspecified role prey prey n/a 854263 unspecified role unspecified role bait bait physical association physical association false false false Figure 3, channel 4. app-2 In cerebrospinal fluid chaperones Erp57 calreticulin and Abeta form a complex 854262 n/a 854264 unspecified role unspecified role neutral component neutral component n/a 854263 unspecified role unspecified role neutral component neutral component n/a 854265 unspecified role unspecified role neutral component neutral component association association false false false The authors comment that their findings suggest that the ERp57 (PDIA3) is bound to abeta and that calreticulin is bound to the PDIA3. Figure 1 and 2.