IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ qi-2005a-2 CASK inhibits ECV304 cell growth and interacts with Id1. human-ecv304 Human umbilical cord, endothelial ECV304 ecv304 Human umbilical cord, endothelial ECV304 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn Human fetal brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2005 qi-2005a-3 CASK inhibits ECV304 cell growth and interacts with Id1. human-ecv304 Human umbilical cord, endothelial ECV304 ecv304 Human umbilical cord, endothelial ECV304 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn Human fetal brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2005 qi-2005a-1 CASK inhibits ECV304 cell growth and interacts with Id1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn Human fetal brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2005 cskp_human Peripheral plasma membrane protein CASK CASK LIN2 Calcium/calmodulin-dependent serine protein kinase Protein lin-2 homolog protein protein human Homo sapiens Human MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY id1_human DNA-binding protein inhibitor ID-1 ID1 ID Inhibitor of DNA binding 1 BHLHB24 Class B basic helix-loop-helix protein 24 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR p41134-1 DNA-binding protein inhibitor ID-1 ID1 BHLHB24 ID Class B basic helix-loop-helix protein 24 Inhibitor of DNA binding 1 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR p41134-2 DNA-binding protein inhibitor ID-1 ID1 BHLHB24 ID Class B basic helix-loop-helix protein 24 Inhibitor of DNA binding 1 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEVRSRSDH cask-id1-2 Interaction of CASK and ID1 identified by coimmunoprecipitation 597704 N/A 597707 unspecified role unspecified role bait bait N/A 597708 unspecified role unspecified role prey prey physical association physical association false false false 2 cask-id1-3 Interaction of CASK and ID1 identified by coimmunoprecipitation 597704 N/A 597708 unspecified role unspecified role bait bait N/A 597707 unspecified role unspecified role prey prey physical association physical association false false false 2 cask-id1-4 Interaction of CASK and ID1 identified by mammalian 2H 597705 N/A 597709 unspecified role unspecified role prey prey N/A 597707 unspecified role unspecified role bait bait physical association physical association false false false 3 cask-id1-5 Interaction of CASK and ID1 identified by mammalian 2H 597705 N/A 597710 unspecified role unspecified role prey prey N/A 597707 unspecified role unspecified role bait bait physical association physical association false false false 3 cask-id1-1 Interaction of CASK and ID1 identified by Y2H 597706 N/A 597708 unspecified role unspecified role prey prey N/A 597707 unspecified role unspecified role bait bait physical association physical association false false false