IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chamberlain-2004-1 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins. in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chamberlain MD., Berry TR., Pastor MC., Anderson DH. Synapse - Interactions of proteins with an established role in the presynapse. Cells were stimulated with PDGF BB for various times before immunoprecipitation was carried out. danderson@scf.sk.ca The antibody used for p85 was specific to the alpha isoform of p85, as described on provider's website (Upstate Biotechnology - now Millipore - cat. no. 05-217). The antibody used for PDGFR was specific for the beta isoform, as decribed on the provider's website (Santa Cruz Biotechnology , cat. no. sc-432). J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer chamberlain-2004-3 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins. in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Chamberlain MD., Berry TR., Pastor MC., Anderson DH. Synapse - Interactions of proteins with an established role in the presynapse. Cells were stimulated with PDGF BB for various times before immunoprecipitation was carried out. danderson@scf.sk.ca The antibody used for p85 was specific to the alpha isoform of p85, as described on provider's website (Upstate Biotechnology - now Millipore - cat. no. 05-217). The antibody used for PDGFR was specific for the beta isoform, as decribed on the provider's website (Santa Cruz Biotechnology , cat. no. sc-432). J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer chamberlain-2004-2 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Chamberlain MD., Berry TR., Pastor MC., Anderson DH. Synapse - Interactions of proteins with an established role in the presynapse. Cells were stimulated with PDGF BB for various times before immunoprecipitation was carried out. danderson@scf.sk.ca The antibody used for p85 was specific to the alpha isoform of p85, as described on provider's website (Upstate Biotechnology - now Millipore - cat. no. 05-217). The antibody used for PDGFR was specific for the beta isoform, as decribed on the provider's website (Santa Cruz Biotechnology , cat. no. sc-432). J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer chamberlain-2004-4 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chamberlain MD., Berry TR., Pastor MC., Anderson DH. Synapse - Interactions of proteins with an established role in the presynapse. Cells were stimulated with PDGF BB for various times before immunoprecipitation was carried out. danderson@scf.sk.ca The antibody used for p85 was specific to the alpha isoform of p85, as described on provider's website (Upstate Biotechnology - now Millipore - cat. no. 05-217). The antibody used for PDGFR was specific for the beta isoform, as decribed on the provider's website (Santa Cruz Biotechnology , cat. no. sc-432). J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer chamberlain-2004-5 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chamberlain MD., Berry TR., Pastor MC., Anderson DH. Synapse - Interactions of proteins with an established role in the presynapse. Cells were stimulated with PDGF BB for various times before immunoprecipitation was carried out. danderson@scf.sk.ca The antibody used for p85 was specific to the alpha isoform of p85, as described on provider's website (Upstate Biotechnology - now Millipore - cat. no. 05-217). The antibody used for PDGFR was specific for the beta isoform, as decribed on the provider's website (Santa Cruz Biotechnology , cat. no. sc-432). J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer chamberlain-2004-6 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chamberlain MD., Berry TR., Pastor MC., Anderson DH. Synapse - Interactions of proteins with an established role in the presynapse. Cells were stimulated with PDGF BB for various times before immunoprecipitation was carried out. danderson@scf.sk.ca The antibody used for p85 was specific to the alpha isoform of p85, as described on provider's website (Upstate Biotechnology - now Millipore - cat. no. 05-217). The antibody used for PDGFR was specific for the beta isoform, as decribed on the provider's website (Santa Cruz Biotechnology , cat. no. sc-432). J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer rab5a_human Ras-related protein Rab-5A RAB5A RAB5 protein protein human Homo sapiens Human MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 p85a_bovin Phosphatidylinositol 3-kinase regulatory subunit alpha Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha PIK3R1 protein protein bovin Bos taurus (Bovine) Bovine MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAEQFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDTASLDLEMFDVHVLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR rab4a_human Ras-related protein Rab-4A RAB4A RAB4 protein protein human Homo sapiens Human MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC rab6a_human Ras-related protein Rab-6A RAB6A RAB6 protein protein human Homo sapiens Human MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL pk3ca_mouse Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphoinositide-3-kinase catalytic alpha polypeptide Serine/threonine protein kinase PIK3CA Pik3ca Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha protein protein mouse Mus musculus Mouse MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQLLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN p85a_mouse Phosphatidylinositol 3-kinase regulatory subunit alpha Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha Pik3r1 protein protein mouse Mus musculus Mouse MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYNETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQALPLPDLAEQFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVHVLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQLLKKLIRLPNIPHQCWLTLQYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNERQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR pgfrb_mouse Platelet-derived growth factor receptor beta CD140 antigen-like family member B Pdgfrb Pdgfr Beta-type platelet-derived growth factor receptor Pdgfr1 Platelet-derived growth factor receptor 1 Beta platelet-derived growth factor receptor protein protein mouse Mus musculus Mouse MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAEDSFL rab5a-gtp p85alpha stimulates Rab5 GTPase activity 679394 N/A 679400 enzyme enzyme unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) N/A 679401 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 679402 stimulator stimulator unspecified role unspecified role P23727:p.Arg274Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P23727:p.Arg151Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region BH domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 1, 2 The addition of p85alpha to the assay substantially accelerated Rab5-mediated hydrolysis of the bound [alpha-32P]GTP to [alpha-32P]GDP, suggesting that p85 stimulates GTP hydrolysis by Rab5 and is not simply promoting nucleotide exchange. p85alpha - Addition of p85 to the assay substantially accelerated Rab5-mediated hydrolysis of the bound [alpha-32P]GTP to [alpha-32P]GDP. Stimulation increased as more p85alpha was added. The BH domain of p85alpha contained substantial Rab5 GAP activity, as deletion mutants lacking this domain showed little or no GAP activity towards Rab5. rab4a-gtp p85alpha stimulates Rab4 GTPase activity 679394 N/A 679403 enzyme enzyme unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) N/A 679401 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 679402 stimulator stimulator unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 4 A rab6a-gtp-1 p85alpha stimulates Rab6 GTPase activity 679394 N/A 679401 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 679404 enzyme enzyme unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) N/A 679402 stimulator stimulator unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 4 A The GTPase activity of Rab6 was stimulated by p85alpha to a lesser degree than Rab5 or Rab4. rac1-gtp p85alpha stimulates Rac1 GTPase activity 679394 N/A 679405 stimulator stimulator unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) N/A 679402 stimulator stimulator unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) N/A 679401 enzyme target enzyme target substrate substrate unspecified role unspecified role enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 4 B p85 had a similar level of GAP activity toward Rac1 as Rab4 and Rab5. cdc42-gtp p85alpha stimulates Cdc42 GTPase activity 679394 N/A 679402 stimulator stimulator unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) N/A 679401 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 679406 enzyme enzyme unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 4 B p85 had a similar level of GAP activity toward Cdc42 as Rab4 and Rab5. rab5a-pik3r1-1 GST-Rab5 pulls down p85alpha in vitro 679395 N/A 679402 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 679400 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 B, C Purified cleaved p85 protein bound best to Rab5 (no nucleotide), followed by Rab5-GTPgammaS. Significant amounts of p85 also bound to the transition state analogue conformation of Rab5 (GDP-AlF4), and to Rab5-GDP.The Rab5S34N mutant preferentially binds GDP, whereas the Rab5Q79L mutant is unable to hydrolyze bound GTP. Purified cleaved p85 bound to both GSTRab5S34N and GST-RabQ79L preloaded with GDP and GTP. rab5a-pik3r1-2 Rab5Q79L-GTP pulls down p85alphaDeltaBH in vitro 679395 N/A 679400 unspecified role unspecified role bait bait P20339:p.Gln79Leu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P20339:p.Ser34Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 679402 unspecified role unspecified role prey prey region p85alphaDeltaBH sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 D Rab5Q79L was loaded with GTP, whereas Rab5S34N was loaded with GDP. rab5a-pik3r1-3 Rab5 mutants pull down p85alphaR151A in vitro 679395 N/A 679402 unspecified role unspecified role prey prey P23727:p.Arg151Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 679400 unspecified role unspecified role bait bait P20339:p.Gln79Leu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P20339:p.Ser34Asn mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 D Rab5Q79L was loaded with GTP, whereas Rab5S34N was loaded with GDP. rab5a-pik3r1-4 Rab5 mutants pull down p85alphaR274A in vitro 679395 N/A 679402 unspecified role unspecified role prey prey P23727:p.Arg274Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 679400 unspecified role unspecified role bait bait P20339:p.Ser34Asn mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P20339:p.Gln79Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 D Rab5Q79L was loaded with GTP, whereas Rab5S34N was loaded with GDP. rab5a-pik3r1 Rab5 binds p85alpha in an ELISA assay 679396 N/A 679400 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) N/A 679402 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 A This interaction was similar in the absence of nucleotide, or in the presence of GDP or GTPgammaS (a non-hydrolyzable form of GTP). pik3r1-pik3ca-3 FLAG-p85alpha coimmunoprecipitates Myc-p110alpha from COS-1 lysates 679397 N/A 679407 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 679402 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 All of the FLAG-p85alpha proteins (wild type, DeltaBH, R274A, and R151A mutants) can associate with the Myc-p110alpha. P42337; P23727 transfection pdgfrb-pik3r1 Endogenous PDGFR coimmunoprecipitates endogenous p85alpha from NIH 3T3 lysates 679398 N/A 679408 unspecified role unspecified role prey prey N/A 679409 unspecified role unspecified role bait bait physical association physical association false false false 6 A PDGF BB - PDGF BB treatment stimulated the interaction before it decreased again with time of treatment. pdgfrb-pik3r1-1 679399 N/A 679402 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 679409 unspecified role unspecified role bait bait physical association physical association false false false 6 A PDGFR coimmunoprecipitates wild-type FLAG-p85 and also DeltaBH and R274A. P23727 transfection PDGF BB - PDGF BB treatment stimulates this interaction. The interaction decreases with time of treatment for FLAG-p85DeltaBH and more markedly for the wild-type protein, but not for FLAG-p85R274A.