IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2004a-1 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 lee-2004a-5 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mouse brain cDNA Mol. Cell (1097-2765) 2004 lee-2004a-3 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 lee-2004a-2 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 lee-2004a-4 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 lee-2004a-6 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 lee-2004a-7 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. biochemical biochemical western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 lee-2004a-8 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 biochemical biochemical western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Cell (1097-2765) 2004 syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK wnk1_rat Serine/threonine-protein kinase WNK1 Wnk1 Prkwnk1 Protein kinase with no lysine 1 Protein kinase lysine-deficient 1 Hsn2 protein protein rat Rattus norvegicus (Rat) Rat MSDGTAEKQSGTPGFLSPPAPVPKNGSSSDSSVGEKLGAAVADSGIGRTEEYRRRRHTMDKDSRGAAATTTPTEHRFFRRSVICDSNATALELPGLPLSIPQPSVPAVVPQSAPPEPHREETLTATVASQVSQQPSAAASPGEQAVVGSATATVPSSTSKDRPVSQPSLVGSKEEPPPSRSGSGSGGASAKEPQEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKRKQEESSFKQQNEQQASVSQAGIQPLSVASTGIPTAPTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSIGTAPGHTVSSIQAQSQPHGVYPPSSMAQGQNQGQPSSSLAGVLSSQPVQHPQQQGIQPTVPPQQAVQYSLPQAASSSEGTVQPVSQPQVSAGTQSSTQGVSQAAPPEQTPITQSQPTQPVPLVSSVDSAHSDVASGMSDGNENAPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVAQVREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDYGFPGSQKLEGEFKQPIAVSSMPQQIGVPTSSLTQVVHSAGRRFIVSPVPESRLRESKIFTSEIPDPVAASTSQGPGMNLSHSASSLSLQQAFSELKHGQMTEGPNTAPPNFNHPGPTFSPFLTSIAGVQTVAASTPSVSVPITSSPLNDISTSVMQSEGALPTDKGIGGVTTSTGVVASGGLTTLSVSETPTLSSAVSSSTAPAVVTVSTTSQPVQASTSGSIASSTGSFPSGTFSTTTGTTVSSVAVPNAKPPTVLLQQVAGNTAGVAIVTSVSTTTPFPAMASQPSLPLGSSTSAPTLAETVVVSAHSLDKASHSSTAGLGLSFCAPSSSSSSGTAVSSSVSQPGIVHPLVISSAIASTPVLPQPAVPTSTPLLPQVPNIPPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHCPEMDADTQSKAPGIDDIKTLEEKLRSLFSEHSSSGTQHASVSLETPLVVETVTPGIPTTAVAPSKLMTSTTSTCLPPTNLPLGTAGMPVMPVGTPGQVSTPGTHASAPASTATGAKPGTTPPKPSLTKTVVPPVGTELSAGTVPCEQLPPFPGPSLIQTQQPLEDLDAQLRRTLSPETIPVTPAVGPLSTMSSTAVTEAGSQPQKDGTEVHVTASSSGAGVVKMGRFQVSVTMDDAQKERKNRSEDTKSVHFESSTSESSVLSSSSPESTLVKPEPNGITVSGISLDVPDSTHRTPTPEAKSETGQPTKVGRFQVTTTANKVGRFSVSRTEDKVTELKKEGPVTSPFRDSEQTVIPAAIPKKEKPELAEPSHLNGPSSDLEAAFLSRGGEDGSGSPHSPPHLCSKSLPIQTLSQSLSNSFNSSYMSSDNESDIEDEDLRLELRRLREKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSGTSVLNPQQTLHPPGNTPETGHNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGGTVSSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNMGGSTPISAASATSLGHFTKSMCPPQQYGFPAAPFGTQWSGTGGPAPQPLGQFQPVGTTSLQNFNISNLQKSISNPPGSNLRTT syt2_rat Synaptotagmin-2 Syt2 Synaptotagmin II protein protein rat Rattus norvegicus (Rat) Rat MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK syt9_rat Synaptotagmin-9 Syt9 Syt5 Synaptotagmin IX Synaptotagmin V Synaptotagmin 5 protein protein rat Rattus norvegicus (Rat) Rat MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLLEKR syt3_mouse Synaptotagmin-3 Syt3 Synaptotagmin III protein protein mouse Mus musculus Mouse MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK syt9_mouse Synaptotagmin-9 Syt9 Syt5 Synaptotagmin IX Synaptotagmin V protein protein mouse Mus musculus Mouse MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQENCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLMEKR wnk1_human Serine/threonine-protein kinase WNK1 WNK1 KDP KIAA0344 PRKWNK1 Protein kinase with no lysine 1 Protein kinase lysine-deficient 1 Erythrocyte 65 kDa protein Kinase deficient protein HSN2 protein protein human Homo sapiens Human MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQGQPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAPQVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYPVSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLLQPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPGGSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQPTTLASSVDSAHSDVASGMSDGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIVSPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPNTAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTEEGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEIVVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPSTASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSYISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLETSLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVSTTTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSDVPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSPHSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASVLHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGTGGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT prkwnk1-syt1-1 yeast two-hybrid : bait =rat WNK, prey = rat synaptotagmin syt1 165125 N/A 165133 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 165134 unspecified role unspecified role bait bait ser_thr_pkin_as kinase domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-syt2-6 yeast two-hybrid : bait =rat WNK, prey = rat synaptotagmin syt2 CA2 domain 165125 N/A 165134 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9JIH7:p.Val318Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 165135 unspecified role unspecified role prey prey P29101:p.Asp231Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false c2a domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-syt2-7 yeast two-hybrid : bait =rat WNK, prey = rat synaptotagmin syt2 C2B domain 165125 N/A 165134 unspecified role unspecified role bait bait Q9JIH7:p.Val318Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 165135 unspecified role unspecified role prey prey P29101:p.Asp310Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false c2b domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-syt2-8 yeast two-hybrid : bait =rat WNK, prey = rat synaptotagmin syt2 C2A -C2B fragment 165125 N/A 165134 unspecified role unspecified role bait bait Q9JIH7:p.Val318Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 165135 unspecified role unspecified role prey prey P29101:p.Asp310Asn D310N mutation prevents binding to WNK1 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false c2a_c2b domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-syt3-1 yeast two-hybrid : bait =rat WNK, prey = rat synaptotagmin syt3 165125 n/a 165134 unspecified role unspecified role bait bait ser_thr_pkin_as kinase domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 165133 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-syt9-1 yeast two-hybrid : bait =rat WNK, prey = rat synaptotagmin syt9 165125 n/a 165136 unspecified role unspecified role prey prey n/a 165134 unspecified role unspecified role bait bait ser_thr_pkin_as kinase domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-1 yeast two-hybrid : bait =rat WNK, prey = mouse synaptotagmin syt3 165126 N/A 165137 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 165134 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false prkwnk1-12 yeast two-hybrid : bait =rat WNK, prey = mouse synaptotagmin syt2 165126 n/a 165138 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 165134 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1A prkwnk1-13 yeast two-hybrid : bait =rat WNK, prey = mouse synaptotagmin syt9 165126 n/a 165134 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 165139 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1A prkwnk1-syt2-3 IP: bait =rat WNK1, prey = rat synaptotagmin syt2 165127 N/A 165135 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 165134 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false prkwnk1-syt2-4 IP: bait =rat synaptotagmin syt2, prey = rat WNK1and endogenous human WNK1 165127 N/A 165140 unspecified role unspecified role prey prey N/A 165135 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 165134 unspecified role unspecified role prey prey ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association false false false prkwnk1-syt2-2 GST pull down: bait =rat GST WNK1, prey = rat synaptotagmin syt2 165128 N/A 165135 unspecified role unspecified role prey prey c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 165134 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false binding is Ca 2+ sensitive (positive effect) prkwnk1-syt2-5 IP: bait =human endogenous WNK1, prey= rat syt2 165129 N/A 165135 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 165140 unspecified role unspecified role prey prey physical association physical association false false false prkwnk1-syt2-9 in vitro phosphorylation assay: kinase=rat GST WNK1, target = rat synaptotagmin syt2 165130 N/A 165134 enzyme enzyme unspecified role unspecified role ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region possible phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 165135 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false syt2 is phosphorylated on Thr202 and Thr386 as detected by mass spectrometry prkwnk1-syt2-10 in vivo phosphorylation assay with IP: kinase =rat WNK1, target = rat synaptotagmin syt2 165131 N/A 165135 enzyme target enzyme target substrate substrate unspecified role unspecified role c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 165134 enzyme enzyme unspecified role unspecified role ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation false false false Syt2 is phosphorylated in vivo as shown with 32P incorporation. prkwnk1-syt2-11 in vivo phosphorylation assay with IP: kinase = rat WNK1, target = rat synaptotagmin syt2 165132 N/A 165135 enzyme target enzyme target substrate substrate unspecified role unspecified role c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 165134 enzyme enzyme unspecified role unspecified role ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation false false false in vivo syt2 phosphorylation T202 detected with an antibody anti-phospho-T202-syt2