IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mattera-2004-1 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. J. Biol. Chem. (0021-9258) 2004 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2004-2 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. J. Biol. Chem. (0021-9258) 2004 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2004-3 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. J. Biol. Chem. (0021-9258) 2004 Synapse - Interactions of proteins with an established role in the presynapse. arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK gga1_human ADP-ribosylation factor-binding protein GGA1 Golgi-localized, gamma ear-containing, ARF-binding protein 1 Gamma-adaptin-related protein 1 GGA1 protein protein human Homo sapiens Human MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL rabe1_human Rab GTPase-binding effector protein 1 Rabaptin-5 Rabaptin-5alpha Rabaptin-4 Renal carcinoma antigen NY-REN-17 RABEP1 RABPT5 RABPT5A RAB5EP protein protein human Homo sapiens Human MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET ts101_human Tumor susceptibility gene 101 protein TSG101 ESCRT-I complex subunit TSG101 protein protein human Homo sapiens Human MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC ap1g1_human AP-1 complex subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Clathrin assembly protein complex 1 gamma-1 large chain AP1G1 ADTG CLAPG1 Adaptor-related protein complex 1 subunit gamma-1 protein protein human Homo sapiens Human MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ rabx5_bovin Rab5 GDP/GTP exchange factor Rabex-5 RABGEF1 RABEX5 protein protein bovin Bos taurus (Bovine) Bovine MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGAKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEAMHYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIRPPNQSVAAIDSENVENDKLPPPLQPQVYAG gga1-arf1-1 two hybrid interaction between GGA1GAT domain and ARF 145820 N/A 145823 unspecified role unspecified role bait bait P84077:p.Gln71Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false P84077:p.Thr32Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 145824 unspecified role unspecified role prey prey Q9UJY5:p.[Leu182Ala;Asn194Ala;Ile197Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false gat domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false constitutively active mutant of Arf1 is used (Q71L) for interaction. No interaction is detected with Arf1 T31N. gga1-rabep1-3 two hybrid interaction between GGA1 GAT domain and Rabaptin-5 145820 N/A 145824 unspecified role unspecified role bait bait N/A 145825 unspecified role unspecified role prey prey physical association physical association false false false GAT domain of GGA1 is used (148-314) Each of the following mutations the F264A, A267D and L277A within the GGA1-GAT domain impairs the interaction with Rabaptin-5. interaction is shown with Rabaptin-5 full-length, 551-661 fragment and 551-862 fragment. gga1-tsg101-1 two hybrid interaction between GGA1 VHS-GAT fragment and TSG101 145820 N/A 145826 unspecified role unspecified role bait bait N/A 145824 unspecified role unspecified role prey prey physical association physical association false false false Each of the following mutations the I197A, L277A and L182A within the GGA1-VHS-GAT fragment impairs the interaction with TSG101. VHS-GAT fragment of GGA1 is used (5-314) gga1-ubc-1 two hybrid interaction between GGA1 VHS-GAT fragment and Ubiquitin 145820 N/A 145824 unspecified role unspecified role prey prey N/A 145827 unspecified role unspecified role bait bait physical association physical association false false false Each of the following mutations the R560E, A267D and L277A within the GGA1-VHS-GAT fragment impairs the interaction with Ubiquitin. VHS-GAT fragment of GGA1 is used (5-314) rabgef1-ap1g1-1 GST pull-down, bait = human Adaptin gamma 1, prey = bovin rabex-5 145820 N/A 145828 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 145829 unspecified role unspecified role prey prey physical association physical association false false false adaptin gamma 1 ear domain is used (707-822) adaptin gamma 1 ear is GST tagged gga1-ubc-2 GGA1 VHS-GAT binds to Ubiquitin-agarose beads 145821 N/A 145824 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 145827 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Each of the following mutations the R560E, A267D and L277A within the GGA1-VHS-GAT fragment impairs the interaction with Ubiquitin. VHS-GAT fragment of GGA1 is used (5-314) GGA1-VHS-GAT fragment is GST tag Rabaptin-5 (551-862) competes with GGA1 binding to Ubiquitin gga1-rabgef1-1 endogenous bovin rabex-1 binds to Ubiquitin-agarose beads 145821 N/A 145829 unspecified role unspecified role prey prey N/A 145827 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false rabex-1 is from bovin brain cytosol gga1-ubc-3 GST pull-down ,bait = human GGA1 ( VHS-GAT fragment), prey = human Ubiquitin 145822 N/A 145827 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 145824 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false GGA1 VHS-GAT fragment (5-314) is used GGA1 VHS-GAT fragment has GST tag Ubiquitin has a His tag