IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ starcevic-2004-2 Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Starcevic M., Dell'Angelica EC. Synapse - Interactions of proteins with an established role in the presynapse. J. Biol. Chem. (0021-9258) 2004 IMEx Library - MATCHMAKER cDNA library (in the pGADT7 vector) derived from HeLa cells (Clontech) Only protein-protein interactions imex curation imex curation starcevic-2004-3 Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1). human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Starcevic M., Dell'Angelica EC. Synapse - Interactions of proteins with an established role in the presynapse. Cells were radiolabelled and participant identification was further confirmed by fluorography. Library - MATCHMAKER cDNA library (in the pGADT7 vector) derived from HeLa cells (Clontech) J. Biol. Chem. (0021-9258) 2004 IMEx Only protein-protein interactions imex curation imex curation starcevic-2004-1 Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Starcevic M., Dell'Angelica EC. Synapse - Interactions of proteins with an established role in the presynapse. Library - MATCHMAKER cDNA library (in the pGADT7 vector) derived from HeLa cells (Clontech) J. Biol. Chem. (0021-9258) 2004 IMEx Only protein-protein interactions imex curation imex curation bl1s6_human Biogenesis of lysosome-related organelles complex 1 subunit 6 BLOC1S6 PA PLDN Pallid protein homolog Pallidin Syntaxin 13-interacting protein protein protein human Homo sapiens Human MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM dtbp1_human Dysbindin My031 DTNBP1 Dystrobrevin-binding protein 1 Hermansky-Pudlak syndrome 7 protein Dysbindin-1 BLOC1S8 Biogenesis of lysosome-related organelles complex 1 subunit 8 protein protein human Homo sapiens Human MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQYLSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNEITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSDS bl1s1_human Biogenesis of lysosome-related organelles complex 1 subunit 1 BLOC1S1 BLOS1 RT14 GCN5L1 GCN5-like protein 1 Protein RT14 protein protein human Homo sapiens Human MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS bl1s4_human Biogenesis of lysosome-related organelles complex 1 subunit 4 BLOC1S4 CNO Protein cappuccino homolog protein protein human Homo sapiens Human MEGSFSDGGALPEGLAEEAEPQGAAWSGDSGTVSQSHSSASGPWEDEGAEDGAPGRDLPLLRRAAAGYAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEAFVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPCCSERPQL bl1s5_human Biogenesis of lysosome-related organelles complex 1 subunit 5 BLOC1S5 MUTED Protein Muted homolog protein protein human Homo sapiens Human MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF bl1s2_human Biogenesis of lysosome-related organelles complex 1 subunit 2 BLOC1S2 BLOS2 CEAP Centrosome-associated protein protein protein human Homo sapiens Human MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR snapn_human SNARE-associated protein Snapin SNAPIN SNAP25BP SNAPAP Synaptosomal-associated protein 25-binding protein BLOC1S7 Biogenesis of lysosome-related organelles complex 1 subunit 7 protein protein human Homo sapiens Human MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK bl1s3_human Biogenesis of lysosome-related organelles complex 1 subunit 3 BLOC1S3 BLOS3 protein protein human Homo sapiens Human MASQGRRRRPLRRPETVVPGEATETDSERSASSSEEEELYLGPSGPTRGRPTGLRVAGEAAETDSEPEPEPEPTAAPRDLPPLVVQRESAEEAWGTEEAPAPAPARSLLQLRLAESQARLDHDVAAAVSGVYRRAGRDVAALASRLAAAQAAGLAAAHSVRLARGDLCALAERLDIVAGCRLLPDIRGVPGTEPEKDPGPRA pldn-pldn-1 Interaction detected by Y2H 166429 N/A 166432 unspecified role unspecified role bait bait N/A 166432 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6B pldn-dtnbp1-2 Interaction detected by Y2H 166429 N/A 166433 unspecified role unspecified role prey prey N/A 166432 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A pldn-bloc1s1-2 Interaction detected by Y2H 166429 N/A 166434 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 166432 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2A, 6A pldn-cno-1 Interaction detected by Y2H 166429 N/A 166435 unspecified role unspecified role prey prey N/A 166432 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A muted-dtnbp1-1 Interaction detected by Y2H 166429 N/A 166433 unspecified role unspecified role prey prey N/A 166436 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A muted-bloc1s2-1 Interaction detected by Y2H 166429 N/A 166436 unspecified role unspecified role bait bait N/A 166437 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A cno-pldn-1 Interaction detected by Y2H 166429 N/A 166435 unspecified role unspecified role bait bait N/A 166432 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A cno-snapap-1 Interaction detected by Y2H 166429 N/A 166438 unspecified role unspecified role prey prey N/A 166435 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A cno-bloc1s2-1 Interaction detected by Y2H 166429 N/A 166435 unspecified role unspecified role bait bait N/A 166437 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A snapap-bloc1s2-1 Interaction detected by Y2H 166429 N/A 166438 unspecified role unspecified role bait bait N/A 166437 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A snapap-dtnbp1-1 Interaction detected by Y2H 166429 N/A 166438 unspecified role unspecified role bait bait N/A 166433 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A bloc1s1-pldn-1 Interaction detected by Y2H 166429 N/A 166432 unspecified role unspecified role prey prey N/A 166434 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2B, 6A bloc1s1-snapap-1 Interaction detected by Y2H 166429 N/A 166434 unspecified role unspecified role bait bait N/A 166438 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A bloc1s1-bloc1s2-1 Interaction detected by Y2H 166429 N/A 166437 unspecified role unspecified role prey prey N/A 166434 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A bloc1s2-cno-1 Interaction detected by Y2H 166429 N/A 166435 unspecified role unspecified role prey prey N/A 166437 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A bloc1s2-snapap-1 Interaction detected by Y2H 166429 N/A 166438 unspecified role unspecified role prey prey N/A 166437 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A bloc1s3-bloc1s2-1 Interaction detected by Y2H 166429 N/A 166439 unspecified role unspecified role bait bait N/A 166437 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A pldn-bloc1s1-3 Interaction detected by co-immunoprecipitation 166430 N/A 166438 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166436 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166433 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166439 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166437 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166432 unspecified role unspecified role bait bait N/A 166434 unspecified role unspecified role prey prey association association false false false Fig. 4 bloc1s2-bloc1s1-1 Interaction detected by co-immunoprecipitation 166430 N/A 166438 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166436 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166433 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166439 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166432 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166437 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166434 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig 4 dtnbp1-bloc1s1-1 Interaction detected by co-immunoprecipitation 166430 N/A 166438 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166436 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166437 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166439 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166432 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166434 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166433 unspecified role unspecified role bait bait association association false false false Fig. 4 bloc1s3-bloc1s1-1 Interaction detected by co-immunoprecipitation 166430 N/A 166438 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166436 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166437 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166433 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166432 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166439 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 166434 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig 4 pldn-dtnbp1-1 Interaction detected by Y2H 166431 N/A 166433 unspecified role unspecified role prey prey N/A 166432 unspecified role unspecified role bait bait physical association physical association false false false pldn-bloc1s1-1 Interaction detected by Y2H 166431 N/A 166432 unspecified role unspecified role bait bait N/A 166434 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false