UniProt UniProt http://www.uniprot.org chin-2002-3 Staring, a novel E3 ubiquitin-protein ligase that targets syntaxin 1 for degradation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chin L.S., Vavalle J.P., Li L. Synapse - Interactions of proteins with an established role in the presynapse. Pull down experiments using rat brain homogenate (fig 4B) and CoIP experiment with endogenous proteins of rat brain (fig 4D) not included as the used anti-syntaxin 1 antibody does not differentiate between Stx1a and Stx1b. Origin of Ubch8 according pmid 11078524. Syntaxin 1 has been assumed to be "Rat" in origin though this is not stated in the publication. lianli@ pharm.emory.edu Rat hippocampal/cortical two-hybrid cDNA library J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation chin-2002-1 Staring, a novel E3 ubiquitin-protein ligase that targets syntaxin 1 for degradation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chin L.S., Vavalle J.P., Li L. Synapse - Interactions of proteins with an established role in the presynapse. Pull down experiments using rat brain homogenate (fig 4B) and CoIP experiment with endogenous proteins of rat brain (fig 4D) not included as the used anti-syntaxin 1 antibody does not differentiate between Stx1a and Stx1b. Origin of Ubch8 according pmid 11078524. lianli@ pharm.emory.edu Rat hippocampal/cortical two-hybrid cDNA library J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation chin-2002-2 Staring, a novel E3 ubiquitin-protein ligase that targets syntaxin 1 for degradation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chin L.S., Vavalle J.P., Li L. Synapse - Interactions of proteins with an established role in the presynapse. Pull down experiments using rat brain homogenate (fig 4B) and CoIP experiment with endogenous proteins of rat brain (fig 4D) not included as the used anti-syntaxin 1 antibody does not differentiate between Stx1a and Stx1b. Origin of Ubch8 according pmid 11078524. lianli@ pharm.emory.edu Rat hippocampal/cortical two-hybrid cDNA library J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation chin-2002-4 Staring, a novel E3 ubiquitin-protein ligase that targets syntaxin 1 for degradation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chin L.S., Vavalle J.P., Li L. Synapse - Interactions of proteins with an established role in the presynapse. Pull down experiments using rat brain homogenate (fig 4B) and CoIP experiment with endogenous proteins of rat brain (fig 4D) not included as the used anti-syntaxin 1 antibody does not differentiate between Stx1a and Stx1b. Origin of Ubch8 according pmid 11078524. lianli@ pharm.emory.edu Rat hippocampal/cortical two-hybrid cDNA library J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation bre1b_rat E3 ubiquitin-protein ligase BRE1B RING-type E3 ubiquitin transferase BRE1B Rnf40 Bre1b RING finger protein 40 Syntaxin-1-interacting RING finger protein protein protein rat Rattus norvegicus (Rat) Rat MSGLSNKRAAGDGGSGPPEKKLNREEKTTTTLIEPIRLGGISSTEEMDSKVLQFKNKKLAERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLQCYENQRELSSSGTEVPGCQEGLTRDVIPRTDPGTSDLREPLPMQFRAPLSEPALAFVVALGASSCEEVELQLQGRMEFSKAAVSRVVEASDRLQRQVEELCQRVYSRGDSEAPGEVARARTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSTETKVLEMETTVEDLQWDIEKLRKREQKLNKHLAEALEQLNSGYYVSGSSTGFQGGQITLSMQKFEMLNAELEENQELANSRMAELEKLQAELQGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLASKNSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPINREMRHLISSLQNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSSHCGPNLSHPDDSGLNALAPGKEDSGPGPGGTPDSKKELALVAGATSVASSVKKEELVSSEDDAQALAPGTQGLPSRGREPEARPKRELREREGPSLGPPPAASTLSRADREKAKAEEARRKESELLKGLRAELKKAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEVDELRSRIRDLEERDRRESKKIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQEQNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREKESFNLKRAQEDISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVLTKCFHVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRVYIS stx1b_rat Syntaxin-1B Stx1b Stx1b2 Syntaxin-1B2 P35B protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL ub2l6_human Ubiquitin/ISG15-conjugating enzyme E2 L6 UBE2L6 UBCH8 Ubiquitin-protein ligase L6 Ubiquitin carrier protein L6 UbcH8 Retinoic acid-induced gene B protein E2 ubiquitin-conjugating enzyme L6 protein protein human Homo sapiens Human MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS rnf40-stx1b 1287609 n/a 1287613 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287614 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4C rnf40-stx1b-1 1287609 n/a 1287613 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287615 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287614 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false Fig 5B stx1b-rnf40 1287610 n/a 1287613 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1287614 unspecified role unspecified role bait bait cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure stx1b-rnf40-1 1287611 n/a 1287613 unspecified role unspecified role prey prey n/a 1287614 unspecified role unspecified role bait bait cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure rnf40-stx1b-2 1287612 n/a 1287613 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287615 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A