IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yu-2001-1 ERK regulates the hepatocyte growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yu CF., Roshan B., Liu ZX., Cantley LG. Synapse - Interactions of proteins with an established role in the presynapse. To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. chengfang.yu@yale.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer yu-2001-2 ERK regulates the hepatocyte growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase. mouse-mimcd_3 Mus musculus mIMDC-3 inner medullary collecting duct cells mimcd_3 mIMCD-3 (murine inner medullary collecting duct cells) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yu CF., Roshan B., Liu ZX., Cantley LG. Synapse - Interactions of proteins with an established role in the presynapse. To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. chengfang.yu@yale.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer gab1_mouse GRB2-associated-binding protein 1 Growth factor receptor bound protein 2-associated protein 1 GRB2-associated binder 1 Gab1 protein protein mouse Mus musculus Mouse MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEDMNKWVRCICDICGFNPTEEDPVKPLTGSSQAPVDSPFAISTAPASSQMEASSVALPPPYQVISLPPHPDTLGLQDDPQDYLLLINCQSKKPEPNRTLFDSAKPTFSETDCNDNVPSHQTPASSQSKHGMNGFFQQQMMYDCPPSRLTSVSGESSLYNLPRSYSHDVLPKESPSSTEADGELYTFNTPSGTAGVETQMRHVSISYDIPPTPGNTYQIPRTFPESTLGQSSKLDTIPDIPPPRPPKPHPTHDRSPVETCGVPRTASDTDSSYCIPPPAGMTPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSLEGFHSQYKIKSVLTAGGVSGEELDENYVPMNPNSPPRQHSGSFTEPIQEPNYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLDIKPLSEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSGEDPNLFASNSLDGGSSPMNKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSMADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKNVK p85a_human Phosphatidylinositol 3-kinase regulatory subunit alpha PIK3R1 GRB1 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha protein protein human Homo sapiens Human MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR grb2_mouse Growth factor receptor-bound protein 2 Grb2 Adapter protein GRB2 SH2/SH3 adapter GRB2 protein protein mouse Mus musculus Mouse MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV pik3r1-gab1 GST-p85 pulls down GAB1 from mIMCD-3 lysates 679859 N/A 679861 unspecified role unspecified role prey prey mouse-mimcd_3 Mus musculus mIMDC-3 inner medullary collecting duct cells mimcd_3 mIMCD-3 (murine inner medullary collecting duct cells) N/A 679862 unspecified role unspecified role bait bait region N-SH2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region C-SH2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 2 A HGF (hepatocyte growth factor) - HGF treatment stimulates this interaction. U0126 - U0126 , a MEK family kinase inhibitor, inhibits this interaction when cells are treated with HGF. gab1-grb2 GAB1 coimmunoprecipitates GRB2 in mIMCD-3 lysates 679860 N/A 679861 unspecified role unspecified role bait bait N/A 679863 unspecified role unspecified role prey prey physical association physical association false false false 4 A