IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fremont-1998-1 Crystal structure of mouse H2-M. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fremont DH., Crawford F., Marrack P., Hendrickson WA., Kappler J. PDBe - Data obtained from the Protein Data Bank Europe fremont@immunology.wustl.edu Immunity (1074-7613) 1998 q31099_mouse H2-DMb2 H2-Mb2 H2-M beta2 protein protein mouse Mus musculus Mouse MAALWLLLLVLSLHCMGAGGFVAHVESTCVLNDAGTPQDFTYCVSFNKDLLACWDPDVGKIVPCEFGVLSRLAEIISNILNEQESLIHRLQNGLQDCATHTQPFWDVLTHRTRAPSVRVAQTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYLALTPSYGDVYTCVVQHSGTSEPIRGDWTPGLSPIQTVKVSVSAATLGLGFIIFCVGFFRWRKSHSSSYTPLPGSTYPEGRH dma_mouse Class II histocompatibility antigen, M alpha chain H2-DMa H2-Ma Ma protein protein mouse Mus musculus Mouse MEHEQKSGAVLLRLLRLLWLLPHSWAVLEASTPVLWDDPQNHTFRHTLFCQDGIPNIGLSETYDEDELFSFDFSQNTRVPRLPDFAEWAQGQGDASAIAFGKSFCEMLMREVSPKLEGQIPVSRGLSVAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVNWQLHSAPVEGASPTSISAVDGLTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENALCGVAFALGVLGTIIGIVFFLCSQRPCSGD h2_dma-h2_dmb2-1 Crystal structure of mouse h2-dm 511615 N/A 511616 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper Stoichiometry: 1.0 N/A 511617 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 79.500%, free 74.400% 3.1A