IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hunsicker_w-2005-1 A novel cryoprotection scheme for enhancing the diffraction of crystals of recombinant cytochrome ba3 oxidase from Thermus thermophilus. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hunsicker-Wang LM., Pacoma RL., Chen Y., Fee JA., Stout CD. PDBe - Data obtained from the Protein Data Bank Europe Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2005 cox1_theth Cytochrome c oxidase subunit 1 cbaA Cytochrome c oxidase polypeptide I Cytochrome c ba(3) subunit I Cytochrome cba3 subunit 1 protein protein theth Thermus thermophilus IRALPWDNPAFVAPVLGLLGFIPGGAGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTLTAMGSLYWLLPNLTGKPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAG cox2_theth Cytochrome c oxidase subunit 2 cbaB ctaC Cytochrome c oxidase polypeptide II Cytochrome c ba(3) subunit II Cytochrome cba3 subunit 2 protein protein theth Thermus thermophilus AYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE coxa_thet8 Cytochrome c oxidase polypeptide 2A cbaD TTHA1133 Cytochrome c oxidase polypeptide IIA Cytochrome c ba(3) subunit IIA Cytochrome cba3 subunit 2A protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEEKPKGALAVILVLTLTILVFWLGVYAVFFARG cbaa-cbab-1 Structure of recombinant cytochrome ba3 oxidase from thermus thermophilus 515727 N/A 515728 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false theth Thermus thermophilus Stoichiometry: 1.0 N/A 515729 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false theth Thermus thermophilus Stoichiometry: 1.0 N/A 515730 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false theth Thermus thermophilus Stoichiometry: 1.0 physical association physical association false false false trimeric, multimeric working 78.300%, free 76.400% 2.3A