IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bono-2004-1 Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bono F., Ebert J., Unterholzner L., Guttler T., Izaurralde E., Conti E. PDBe - Data obtained from the Protein Data Bank Europe EMBO Rep. (1469-221X) 2004 mgn_drome Protein mago nashi mago mgn CG9401 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI rbm8a_drome RNA-binding protein 8A tsu Y14 CG8781 Protein tsunagi protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR pym_drome Partner of Y14 and mago Pym Protein within the bgcn gene intron wibg CG30176 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTYLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPLLAAESKKEREKQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQQPSGSRDINSISKTLEDTLKLDAAQEVVDPAKQLKKLRKKIREIEQIESRIQAGEQKKLDKDQLDKVKKKSEILRQIKDLESTPRS mago-tsu-8 Structure of the cytosolic protein pym bound to the mago- 514388 N/A 514389 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 514390 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 514391 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false trimeric, multimeric working 76.5%, free 75.1% 1.9A Table 1 Figure 2