IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ omi-2002-1 Structure of imidazole glycerol phosphate synthase from Thermus thermophilus HB8: open-closed conformational change and ammonia tunneling. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Omi R., Mizuguchi H., Goto M., Miyahara I., Hayashi H., Kagamiyama H., Hirotsu K. PDBe - Data obtained from the Protein Data Bank Europe J. Biochem. (0021-924X) 2002 his6_thet8 Imidazole glycerol phosphate synthase subunit HisF hisF TTHA1444 IGP synthase cyclase subunit IGP synthase subunit HisF ImGP synthase subunit HisF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFGAQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAGAEAALAASVFHFGEIPIPKLKRYLAEKGVHVRLD his5_thet8 Imidazole glycerol phosphate synthase subunit HisH hisH TTHA0430 IGP synthase subunit HisH ImGP synthase subunit HisH IGP synthase glutaminase subunit protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRMKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYFEVL hisf-hish-1 Imidazole glycerol phosphate synthase 513282 N/A 513283 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 513284 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 79.700%, free 74.400% 2.3A