IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ maita-2002-1 Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Maita N., Okada K., Hatakeyama K., Hakoshima T. PDBe - Data obtained from the Protein Data Bank Europe Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 gch1_rat GTP cyclohydrolase 1 Gch1 Gch GTP cyclohydrolase I protein protein rat Rattus norvegicus (Rat) Rat MEKPRGVRCTNGFPERELPRPGASRPAEKSRPPEAKGAQPADAWKAGRPRSEEDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS gfrp_rat GTP cyclohydrolase 1 feedback regulatory protein Gchfr Gfrp GTP cyclohydrolase I feedback regulatory protein p35 protein protein rat Rattus norvegicus (Rat) Rat MPYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVNDPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE gch1-gchfr-1 Crystal structure of rat gtpchi-gfrp stimulatory complex 512800 N/A 512801 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 10.0 N/A 512802 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 10.0 direct interaction direct interaction false false false eicosameric, multimeric working 77.200%, free 73.600% 2.8A gch1-gchfr-2 Crystal structure of rat gtpchi-gfrp stimulatory complex plus zn 512800 N/A 512802 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 10.0 N/A 512801 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 10.0 direct interaction direct interaction false false false eicosameric, multimeric working 78.100%, free 75.500% 2.7A