IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ todone-2001-1 Structure of an archaeal homolog of the eukaryotic RNA polymerase II RPB4/RPB7 complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Todone F., Brick P., Werner F., Weinzierl RO., Onesti S. Archaea - Interaction dataset based on Archaea proteins Mol. Cell (1097-2765) 2001 PDBe - Data obtained from the Protein Data Bank Europe rpo4_metja DNA-directed RNA polymerase subunit Rpo4 rpo4 DNA-directed RNA polymerase subunit F rpoF MJ0039 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MYQAKRERMIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI rpo7_metja DNA-directed RNA polymerase subunit Rpo7 rpo7 DNA-directed RNA polymerase subunit E DNA-directed RNA polymerase subunit E' rpoE rpoE1 MJ0397 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKREAIIGKETGKVLEIGDYVRARIVAISLKAERKRGSKIALTMRQPYLGKLEWIEEEKAKKQNQE rpoe1-y039-1 Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4-rpb7 complex 512732 N/A 512733 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 512734 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false dimeric, multimeric working 78.300%, free 76.200% 1.75A