IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ moraes-2001-1 Crystal structure of the human ubiquitin conjugating enzyme complex, hMms2-hUbc13. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Moraes TF., Edwards RA., McKenna S., Pastushok L., Xiao W., Glover JN., Ellison MJ. PDBe - Data obtained from the Protein Data Bank Europe Nat. Struct. Biol. (1072-8368) 2001 ub2v2_human Ubiquitin-conjugating enzyme E2 variant 2 MMS2 homolog Enterocyte differentiation-associated factor 1 Enterocyte differentiation-promoting factor 1 Vitamin D3-inducible protein DDVit 1 UBE2V2 MMS2 UEV2 protein protein human Homo sapiens Human MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN ube2n_human Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme UBE2N BLU UbcH13 E2 ubiquitin-conjugating enzyme N protein protein human Homo sapiens Human MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI ube2n-ube2v2-1 Crystal structure of hmms2-hubc13 512526 N/A 512527 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 512528 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 78.500%, free 75.600% 1.85A