IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ verslues-2007-2 Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Arabidopsis seedling cDNA library verslues-2007-3 Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Arabidopsis seedling cDNA library verslues-2007-4 Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Arabidopsis seedling cDNA library verslues-2007-1 Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Arabidopsis seedling cDNA library Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation verslues-2007-5 Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Transgenic arabisopsis plants expressing TAP tagged SOS2 protein were treated with 150 mM NaCl for 24 h (stressed) or without salt treatment (unstressed) prior to assay. jian-kang.zhu@ucr.edu Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Arabidopsis seedling cDNA library cipke_arath CBL-interacting serine/threonine-protein kinase 14 CIPK14 At5g01820 PKS24 SnRK3.15 SR1 SOS2-like protein kinase PKS24 SNF1-related kinase 3.15 Serine/threonine-protein kinase SR1 T20L15.90 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATGQSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKGGELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDFGLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPFNDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYDDRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERFVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEVRKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS ndk2_arath Nucleoside diphosphate kinase II, chloroplastic NDPK2 At5g63310 MDC12.28 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRRLRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE cipko_arath CBL-interacting serine/threonine-protein kinase 24 SNF1-related kinase 3.11 Protein SALT OVERLY SENSITIVE 2 CIPK24 SnRK3.11 SOS2 At5g35410 F6I13.1 K21B8.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKKMRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWRATEGIPKSEILRTITF cata2_arath Catalase-2 CAT2 CAT M4E13.140 At4g35090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI cata3_arath Catalase-3 CAT3 F2D10.40 F5M15.5 At1g20620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNLTDEEAKVVGGANHSHATKDLHDAIASGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI cnbl4_arath Calcineurin B-like protein 4 Protein SALT OVERLY SENSITIVE 3 CBL4 SOS3 At5g24270 MOP9.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRNRNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDFVSLNPSLIKNMTLPYLKDINRTFPSFVSSCEEEEMELQNVSS cipkb_arath CBL-interacting serine/threonine-protein kinase 11 SOS2-like protein kinase PKS5 SNF1-related kinase 3.22 SOS3-interacting protein 4 CIPK11 PKS5 SIP4 SnRK3.22 At2g30360 T9D9.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPEIEIAAGSGDNNDALFGKYELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTNPALANNIKREISIMRRLSHPNIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGRLSEDLSRRYFQQLISAVGYCHARGVYHRDLKPENLLIDENGNLKVSDFGLSALTDQIRPDGLLHTLCGTPAYVAPEILSKKGYEGAKVDVWSCGIVLFVLVAGYLPFNDPNVMNMYKKIYKGEYRFPRWMSPDLKRFVSRLLDINPETRITIDEILKDPWFVRGGFKQIKFHDDEIEDQKVESSLEAVKSLNAFDLISYSSGLDLSGLFAGCSNSSGESERFLSEKSPEMLAEEVEGFAREENLRMKKKKEEEYGFEMEGQNGKFGIGICISRLNDLLVVVEARRRGGDGDCYKEMWNGKLRVQLIRVCDQTSSTNAAI snrk3_15-ndpk2 Interaction of SnRK3.15 protein and NDPK2 protein 669051 N/A 669056 unspecified role unspecified role bait bait N/A 669057 unspecified role unspecified role prey prey physical association physical association false false false 1C sos2-cat2 Interaction between SOS2 protein and CAT2 protein 669051 N/A 669058 unspecified role unspecified role bait bait Q9LDI3:p.Lys40Asn mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false N/A 669059 unspecified role unspecified role prey prey physical association physical association false false false 6A sos2-cat3 Interaction between SOS2 protein and CAT3 protein 669051 N/A 669058 unspecified role unspecified role bait bait N/A 669060 unspecified role unspecified role prey prey physical association physical association false false false 6B sos2-ndpk2-1 Interaction of SOS2 protein and NDPK2 protein 669051 N/A 669057 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 669058 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A, 2A,2B ndpk2-sos2 Interaction between NDPK2 protein and SOS2 protein 669052 N/A 669058 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 669057 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1B sos3-sos2-3 Interaction between SOS3 protein and SOS2 protein 669052 N/A 669058 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 669061 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1B ndpk2-ndpk2 Autophosphorylation of NDPK2 669053 N/A 669057 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 669057 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation false false false 3 The authors concluded that "This is consistent with previous reports that wild type NDPK2 exists almost exclusively in a hexameric form (28) and our results imply that SOS2 inhibited autophosphorylation of the NDPK2 hexamer or other multimeric form of NDPK2". The SOS2 protein and kinase-dead SOS2 inhibited autophosphorylation of NDPK2 protein. Phosphorylation of NDPK2 protein. snrk3_22-snrk3_22 Autophosphorylation of SnRK3.22 669053 N/A 669062 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 669062 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation false false false 3 The authors note that "We also note that SnRK3.22 itself had a much higher autophosphorylation activity (Figure 3C) than that of SOS2". Phosphorylation of SnRK3.22 protein. sos2-ndpk2 Interaction between SOS2 protein and NDPK2 protein 669054 N/A 669057 unspecified role unspecified role prey prey N/A 669058 unspecified role unspecified role bait bait physical association physical association false false false sos2-cat2-cat3 Interaction between SOS2, CAT2 and CAT3 proteins 669055 N/A 669060 unspecified role unspecified role prey prey N/A 669059 unspecified role unspecified role prey prey N/A 669058 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6A , 6B LC-MS/MS analysis detected a number of peptides from both CAT2and CAT3 in protein complexes isolated from salt-stressed plants but not unstressed plants. The authors concluded " salt stress may be required to promote interaction between SOS2 and the CAT2 CAT3 proteins"|. Pretreatment of plants using with 150 mM NaCl for 24 h stimulated CAT2 interaction.