IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2015a-7 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-1 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease Figure 5A and 5B also shows co-precipitation of RelA promoter DNA with anti-acetylated histone H3 antibody; however, due to the broad specificity of anti-H3 antibodies, the exact identity of the H3 participant cannot be established, hence this interaction is not captured here. Similar to binding of H4, the interaction was inhibited by transfection with pcDNA3-ZBTB2 expression vector and promoted by transfection with anti-ZBTB2 siRNA. The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-5 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-3 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-8 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. in vitro In vitro dnase 1 footprinting DNase I footprinting dnase 1 footprinting nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-2 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease RE-ChIP: sequential ChIP where immunoprecipitates from a first round of IP were re-precipitated with a second antibody, allowing for the identification of multiple (concurrently binding) proteins on a single DNA sequence. The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-4 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. in vitro In vitro pull down pull down autoradiography autoradiography Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-6 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation kim-2015a-9 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kim M.Y., Koh D.I., Choi W.I., Jeon B.N., Jeong D.Y., Kim K.S., Kim K., Kim S.H., Hur M.W. IBD - Inflammatory bowel disease The expression construct for ZBTB2 lacking the POZ domain is described in PMID:19380588. The origin of the pcDNA3-RelA/p65 and pcDNA3-Sp1 expression constructs, in vitro translated Sp1, and recombinant Sp1 and His-tagged ZBTB2 was confirmed to be human by the corresponding author. Details on recombinant Sp1 were obtained from the supplier's website (Enzo Life Sciences). mwhur2@yuhs.ac Nucleic Acids Res. (0305-1048) 2015 Only protein-protein interactions imex curation sp1_human Transcription factor Sp1 SP1 TSFP1 protein protein human Homo sapiens Human MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF tf65_human_gc-box3-2_dna-probe Human TF65 gene promoter GC-box_3-2 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CCCTGCGCGGGGCGGGCGGCCGCAG tf65_human_gc-box7_dna-probe Human TF65 gene promoter GC-box_7 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CTCCAGGCGGGGCCGGGACCCGGGA tf65_human_gc-box12_dna-probe Human TF65 gene promoter GC-box_12 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CACTTGCTCCCGGCCCCTGCGCCGG zbtb2_human Zinc finger and BTB domain-containing protein 2 ZBTB2 KIAA1483 ZNF437 protein protein human Homo sapiens Human MDLANHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSECVRLKPTDIQPDIFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFSHPDQVFPLASSLYGIQIADHQLRQATKIASAPEKLGRDPRPQTSRISQEQVPEASQLSQLTSNLAQVNRTNMTPSDPLQTSLSPELVSTPVPPPPPGEETNLEASSSDEQPASLTIAHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRVPLTLCSNAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKRRKYECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTMVDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIKKEQETVLLD tf65_human_gene Transcription factor p65 (RELA) human gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG ncor1_human Nuclear receptor corepressor 1 NCOR1 KIAA1047 protein protein human Homo sapiens Human MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD tf65_human_gc-box3_dna-probe Human TF65 gene promoter GC-box_3 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GATCTTTCCCTGCGCGGGGCGGGCGGCCGCAGCCC ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS prgc1_human Peroxisome proliferator-activated receptor gamma coactivator 1-alpha Ligand effect modulator 6 PPARGC1A LEM6 PGC1 PGC1A PPARGC1 protein protein human Homo sapiens Human MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQGQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR pdk4_human_gene [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial gene gene gene human Homo sapiens Human tf65-sp1-3 1780071 n/a 1780080 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1780081 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 4b transfection with pcDNA3-ZBTB2 expression vector tf65-sp1-4 1780071 n/a 1780082 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780080 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 4b tf65-sp1-5 1780071 n/a 1780080 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1780083 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 4b tf65-zbtb2-1 1780071 n/a 1780083 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 4b tf65-zbtb2-2 1780071 n/a 1780082 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 4b tf65-zbtb2-3 1780071 n/a 1780081 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 4b zbtb2-tf65 1780072 n/a 1780085 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1780084 unspecified role unspecified role bait bait association association false false false Fig. 4c, 4d transfection with anti-ZBTB2 siRNA Q8N680 decreases expression at RNA level of ENSG00000173039 Q8N680 decreases expression at protein level of ENSG00000173039 sp1-tf65-1 1780072 n/a 1780080 unspecified role unspecified role bait bait n/a 1780085 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4c, 4d transfection with pcDNA3-ZBTB2 expression vector transfection with anti-ZBTB2 siRNA P08047 increases expression at RNA level of ENSG00000173039 P08047 increases expression at protein level of ENSG00000173039 Q8N680 decreases binding of P08047 to ENSG00000173039 hist1h4a-tf65 1780072 n/a 1780085 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1780086 unspecified role unspecified role bait bait possible acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5b transfection with anti-ZBTB2 siRNA transfection with pcDNA3-ZBTB2 expression vector Q8N680 decreases binding of P62805 to ENSG00000173039 ncor1-tf65 1780072 n/a 1780085 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1780087 unspecified role unspecified role bait bait association association false false false Fig. 5a, 5b transfection with pcDNA3-ZBTB2 expression vector transfection with anti-ZBTB2 siRNA Q8N680 increases binding of O75376 to ENSG00000173039 tf65-sp1 1780073 n/a 1780088 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780080 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Fig. 4a tf65-sp1-1 1780073 n/a 1780080 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1780088 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780088 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 4a tf65-tf65 1780073 n/a 1780084 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false znf_c2h2-like domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) n/a 1780088 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780088 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 4a tf65-zbtb2 1780073 n/a 1780084 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false znf_c2h2-like domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) n/a 1780088 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Fig. 4a sp1-zbtb2 1780074 n/a 1780080 unspecified role unspecified role bait bait naturally occurring naturally occurring endogenous endogenous n/a 1780084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 3a zbtb2-sp1 1780074 n/a 1780080 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous n/a 1780084 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 3b rela-nfkbia-17 1780074 n/a 1780089 unspecified role unspecified role prey prey n/a 1780090 unspecified role unspecified role bait bait physical association physical association false false false Suppl. fig. 5b transfection with pcDNA3-ZBTB2 expression vector tf65-sp1-6 1780075 n/a 1780085 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1780080 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Fig. 3a ZBTB2 bound to the exactly same regions recognized by Sp1. tf65-zbtb2-4 1780075 n/a 1780084 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 1780085 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 3a ZBTB2 bound to the exactly same regions recognized by Sp1. sp1-tf65-2 1780076 n/a 1780080 unspecified role unspecified role bait bait n/a 1780085 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1780084 unspecified role unspecified role prey prey association association false false false Fig. 4f This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-ZBTB2 antibody. Less RelA promoter DNA co-precipitated when cells were transfected with pcDNA3-ZBTB2 expression vector. zbtb2-sp1-1 1780077 n/a 1780084 unspecified role unspecified role bait bait znf_c2h2-like domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false btb_poz domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobd Escherichia coli (strain B / BL21-DE3) n/a 1780080 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Suppl. Fig. 3c Very weak binding of the ZBTB2 POZ domain to Sp1 can be seen . tf65-sp1-2 1780078 n/a 1780088 unspecified role unspecified role bait bait datp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1780080 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Fig. 4a ppargc1a-pdk4 1780079 n/a 1780091 unspecified role unspecified role bait bait n/a 1780092 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7b transfection with pcDNA3-ZBTB2 expression vector Q8N680 increases binding of Q9UBK2 to ENSG00000004799