IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lin-2014b-1 Transcriptional regulation of STAT3 by SPTBN1 and SMAD3 in HCC through cAMP-response element-binding proteins ATF3 and CREB2. human-snu-449 human hepatocellular carcinoma cell line. snu-449 human hepatocellular carcinoma cell line. liver liver ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Lin L., Yao Z., Bhuvaneshwar K., Gusev Y., Kallakury B., Yang S., Shetty K., He A.R. IBD - Inflammatory bowel disease aiwu.r.he@gunet.georgetown.edu Carcinogenesis (0143-3334) 2014 Only protein-protein interactions imex curation lin-2014b-2 Transcriptional regulation of STAT3 by SPTBN1 and SMAD3 in HCC through cAMP-response element-binding proteins ATF3 and CREB2. human-plc_prf_5 Homo sapiens PLC/PRF/5 malignant liver hepatoma cell line plc-prf-5 PLC/PRF/5 Human malignant liver hepatoma cell line This cell line is often referred to as "PLC5" ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Lin L., Yao Z., Bhuvaneshwar K., Gusev Y., Kallakury B., Yang S., Shetty K., He A.R. IBD - Inflammatory bowel disease aiwu.r.he@gunet.georgetown.edu Carcinogenesis (0143-3334) 2014 Only protein-protein interactions imex curation stat3_human_gene Signal transducer and activator of transcription 3 (STAT3) human gene gene gene human Homo sapiens Human sptb2_human Spectrin beta chain, non-erythrocytic 1 SPTBN1 SPTB2 Spectrin, non-erythroid beta chain 1 Beta-II spectrin Fodrin beta chain protein protein human Homo sapiens Human MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS atf3_human Cyclic AMP-dependent transcription factor ATF-3 Activating transcription factor 3 ATF3 protein protein human Homo sapiens Human MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. sptbn1-stat3-3 1599163 n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1599166 unspecified role unspecified role bait bait association association false false false Suppl. Fig. S3 siRNA targeting SMAD3 smad3-stat3-4 1599163 n/a 1599167 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Suppl. Fig. S3 siRNA targeting SPTBN1 atf3-stat3-4 1599163 n/a 1599168 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Suppl. Fig. S3 siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SMAD3 siRNA. atf4-stat3-4 1599163 n/a 1599169 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Suppl. Fig. S3 siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SMAD3 siRNA. sptbn1-stat3-2 1599163 n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1599166 unspecified role unspecified role bait bait association association false false false Suppl. Fig. S3 smad3-stat3-2 1599163 n/a 1599167 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Suppl. Fig. S3 siRNA targeting SPTBN1 atf3-stat3-2 1599163 n/a 1599168 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Suppl. Fig. S3 siRNA targeting SPTBN1 siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SPTBN1 or anti-SMAD3 siRNA. atf4-stat3-2 1599163 n/a 1599169 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Suppl. Fig. S3 siRNA targeting SPTBN1 Binding was only detected in cells treated with anti-SPTBN1 siRNA. sptbn1-stat3-1 1599164 n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1599166 unspecified role unspecified role bait bait association association false false false Fig. 5a Q01082 decreases expression at RNA level of ENSG00000168610 Q01082 decreases expression at protein level of ENSG00000168610 smad3-stat3-1 1599164 n/a 1599167 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a P84022 decreases expression at RNA level of ENSG00000168610 P84022 decreases expression at protein level of ENSG00000168610 atf3-stat3-1 1599164 n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1599168 unspecified role unspecified role bait bait association association false false false Fig. 5a siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SMAD3 siRNA. P18847 increases expression at RNA level of ENSG00000168610 P18847 increases expression at protein level of ENSG00000168610 Q01082 decreases binding of P18847 to ENSG00000168610 P84022 decreases binding of P18847 to ENSG00000168610 atf4-stat3-1 1599164 n/a 1599169 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p1 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SMAD3 siRNA. P18848 increases expression at RNA level of ENSG00000168610 P18848 increases expression at protein level of ENSG00000168610 Q01082 decreases binding of P18848 to ENSG00000168610 P84022 decreases binding of P18848 to ENSG00000168610 smad3-stat3-3 1599164 n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1599167 unspecified role unspecified role bait bait association association false false false Fig. 5a atf3-stat3-3 1599164 n/a 1599168 unspecified role unspecified role bait bait n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a siRNA targeting SPTBN1 siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SPTBN1 or anti-SMAD3 siRNA. atf4-stat3-3 1599164 n/a 1599165 unspecified role unspecified role prey prey promoter region p2 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1599169 unspecified role unspecified role bait bait association association false false false Fig. 5a siRNA targeting SPTBN1 siRNA targeting SMAD3 Binding was only detected in cells treated with anti-SPTBN1 or anti-SMAD3 siRNA.