IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pabbisetty-2014-1 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Pabbisetty SK., Rabacal W., Maseda D., Cendron D., Collins PL., Hoek KL., Parekh VV., Aune TM., Sebzda E. IBD - Inflammatory bowel disease CD4+CD25− T cells that were TCR-stimulated in the presence (iTregs) or absence (mock control) of TGF-beta. eric.sebzda@vanderbilt.edu Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse klf2_mouse Krueppel-like factor 2 Klf2 Lklf Lung krueppel-like factor protein protein mouse Mus musculus Mouse MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSMGLDGLGAENPPEPPPQPPPPAFYYPEPGAPPPYSIPAASLGTELLRPDLDPPQGPALHGRFLLAPPGRLVKAEPPEVDGGGYGCAPGLAHGPRGLKLEGAPGATGACMRGPAGRPPPPPDTPPLSPDGPLRIPASGPRNPFPPPFGPGPSFGGPGPALHYGPPAPGAFGLFEDAAAAAAALGLAPPATRGLLTPPSSPLELLEAKPKRGRRSWPRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHCNWEGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG klf2-foxp3-1 1853573 N/A 1853574 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cns1_cns2_cns3_enhancer_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853575 unspecified role unspecified role bait bait association association false false false 4A TGF-beta CHEBI:9150 increases expression at protein level of Q60843. CHEBI:9150 increases expression at RNA level of Q60843. CHEBI:65329 increases expression at protein level of Q60843. CHEBI:77954 increases expression at protein level of Q60843. CHEBI:9168 increases expression at protein level of Q60843. klf2-foxp3-2 1853573 N/A 1853574 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cns1_cns2_cns3_enhancer_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853576 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4B TGF-beta Q60843 is required for the binding of P62806 to ENSMUSG00000039521