IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ogawa-2014-1 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease Results from ChIps using STAT5 antibody have not been included due to lack of antibody specificity. iTreg (TGF-beta induced TReg cells) EMSA Supershift experiment results have not been included due to lack of STAT5 antibody specificity. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation ogawa-2014-3 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease Results from ChIps using STAT5 antibody have not been included due to lack of antibody specificity. CD4+CD25− T cells were cultured with TGF-beta + anti-CD3 + anti-CD28 and IL-2 for up to 72 hours. EMSA Supershift experiment results have not been included due to lack of STAT5 antibody specificity. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation ogawa-2014-4 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease nTreg (natural TReg cells). EMSA Supershift experiment results have not been included due to lack of STAT5 antibody specificity. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation ogawa-2014-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M., Ogawa C., Tone Y., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease EMSA Supershift experiment results have not been included due to lack of STAT5 antibody specificity. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation foxo3_mouse_gene Forkhead box protein O3 Foxo3 Fkhr2 Foxo3a gene gene mouse Mus musculus Mouse h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG jun_mouse Transcription factor AP-1 Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog AH119 Jun protein protein mouse Mus musculus Mouse MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF fos_mouse Proto-oncogene c-Fos Fos Cellular oncogene fos protein protein mouse Mus musculus Mouse MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL creb1_mouse Cyclic AMP-responsive element-binding protein 1 Creb1 Creb-1 protein protein mouse Mus musculus Mouse MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD wt_cns2_enhancer_probe ds dna double stranded deoxyribonucleic acid ds DNA ds dna mouse Mus musculus Mouse CCAGATGGACGTCACCTACCACATCCGCTAGC hist1h4h-foxo3-2 1855325 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855330 unspecified role unspecified role bait bait possible_acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1A, 8 The 5' half of the CNS2 were highly acetylated in nTreg and TGF-beta activated iTReg cells, but not in CD3/28 activated cells. CHEBI:87662 -Stat5 inhibitor CHEBI:87103 JAK inhibitor CHEBI:87662 decreases the binding of P62806 to ENSMUSG00000048756 CHEBI:87103 inhibits the binding of P62806 to SMUSG00000048756 jun-foxo3-1 1855325 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855331 unspecified role unspecified role bait bait association association false false false 4 E Interaction was seen in nTReg and iTReg cells. fos-foxo3-1 1855325 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855332 unspecified role unspecified role bait bait association association false false false 8 CHEBI:87103 JAK inhibitor CHEBI:87662 STAT5 inhibitor CHEBI:87662 decreases the binding of P01101 to ENSMUSG00000048756 CHEBI:87103 inhibits binding of P01101 to ENSMUSG00000048756 creb1-foxo3-2 1855325 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855333 unspecified role unspecified role bait bait association association false false false 8 CHEBI:87103 - JAK inhibitor CHEBI:87662 STAT5 inhibitor CHEBI:87103 inhibits binding of Q01147 to ENSMUSG00000048756 CHEBI:87662 decreases the binding of Q01147 to ENSMUSG00000048756 CHEBI:87103 decreases the expression of ENSMUSG00000048756 at protein level. hist1h4h-foxo3-3 1855326 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855330 unspecified role unspecified role bait bait possible_acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7D Stat5 binding to this region was detected at 18hrs after stimulation and then gradually diminished;however binding of AcH4, c-Fos and Creb1 are at low levels at 18hrs, but increase by 48hrs, and are greatest at 72hrs. fos-foxo3-2 1855326 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855332 unspecified role unspecified role bait bait association association false false false 7D Stat5 binding to this region was detected at 18hrs after stimulation and then gradually diminished;however binding of AcH4, c-Fos and Creb1 are at low levels at 18hrs, but increase by 48hrs, and are greatest at 72hrs. creb1-foxo3-1 1855326 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855333 unspecified role unspecified role bait bait association association false false false 7Di Stat5 binding to this region was detected at 18hrs after stimulation and then gradually diminished;however binding of AcH4, c-Fos and Creb1 are at low levels at 18hrs, but increase by 48hrs, and are greatest at 72hrs. hist1h4h-foxo3-4 1855327 N/A 1855330 unspecified role unspecified role bait bait possible_acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1A The 5' half of the CNS2 were highly acetylated in nTreg and TGF-beta activated iTReg cells, but not in CD3/28 activated cells. CHEBI:87662 -Stat5 inhibitor CHEBI:87103 JAK inhibitor CHEBI:87662 decreases the binding of P62806 to ENSMUSG00000048756 CHEBI:87103 inhibits the binding of P62806 to SMUSG00000048756 jun-foxo3-2 1855327 N/A 1855329 unspecified role unspecified role prey prey cns2_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855331 unspecified role unspecified role bait bait association association false false false 4 F Interaction was seen in nTReg and iTReg cells. wt_cns2_enhancer_probe-jun-1 1855328 N/A 1855331 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes N/A 1855334 unspecified role unspecified role bait bait A9G,C10G,G11T,T12A,A14C,A21G,C22G,A23T,T24A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 4C FLAG-c-Fos was also detected, but the origin of this construct is not stated. This interaction was seen in cells activated by anti-CD3/28, with and without TGF-beta, but not in non-activated cells. The Bait is stated to be a 102 bp DNA fragment containing three copies of the 32bp sequence given in Fig 4A. However the exact sequence is not stated, so the 32 bp sequence only has been entered here.