IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2013e-1 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation kim-2013e-5 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Figure 2 A/C refers to Pin1 and COT as having 166 and 468 residues, respectively; however, UniProt and NCBI identifiers for the longest isoforms refer to human proteins with 163 and 467 amino acids, respectively, as do all historic UniProt sequences. No other species (in Uniprot) would appear to have 166 residues for Pin1 or 468 residues for COT. Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation kim-2013e-6 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation kim-2013e-2 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation kim-2013e-3 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation kim-2013e-4 COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation m3k8_human Mitogen-activated protein kinase kinase kinase 8 MAP3K8 COT ESTF Serine/threonine-protein kinase cot Cancer Osaka thyroid oncogene Tumor progression locus 2 Proto-oncogene c-Cot protein protein human Homo sapiens Human MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE pin1-map3k8 1763555 n/a 1763561 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P41279:p.Ser413Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P41279:p.Ser400Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1763562 unspecified role unspecified role bait bait n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1b, 2f map3k8-pin1 1763555 n/a 1763561 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P41279:p.Ser400Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P41279:p.Ser413Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1763562 unspecified role unspecified role prey prey n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1c, 2e pin1-map3k8-2 1763556 n/a 1763562 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ww_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1763561 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 2b map3k8-pin1-3 1763556 n/a 1763562 unspecified role unspecified role prey prey n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1763561 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2d map3k8-pin1-5 1763557 n/a 1763562 enzyme target enzyme target substrate substrate neutral component neutral component region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli n/a 1763561 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false prot_kinase_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation false false false Q13526 ser-16 O-phospho-L-serine Q13526 phosphorylation Fig. 3a P41279 is required for phosphorylation of Q13526 CHEBI:37537 increases binding of P41279 to Q13526 In vivo protein kinase assays using anti-phosphoserine-16 Pin1 antibody indicated that COT phosphorylates Pin1 at serine-16. map3k8-1 1763557 n/a 1763561 putative self putative self putative self putative self n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false prot_kinase_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation false true false Fig. 3a P41279 is required for phosphorylation of P41279 P41279 phosres map3k8-pin1-1 1763558 n/a 1763562 unspecified role unspecified role prey prey n/a 1763561 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1d 12-O-Tetradecanoylphorbol 13-acetate (TPA) (CHEBI:37537) According to the text this interaction involves Myc-tagged COT and Xpress-tagged Pin1, which were both transfected in MCF7 cells; however, from the figure legend it appears that binding of endogenous Pin1 to Myc-tagged COT was investigated. map3k8-pin1-2 1763559 n/a 1763561 unspecified role unspecified role bait bait n/a 1763562 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1e 12-O-Tetradecanoylphorbol 13-acetate (TPA) (CHEBI:37537) pin1-map3k8-1 1763560 n/a 1763562 acceptor acceptor bait bait n/a 1763561 acceptor acceptor prey prey physical association physical association false false false Fig. 1a