IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kang-2013b-2 Interleukin (IL)-32β-mediated CCAAT/enhancer-binding protein α (C/EBPα) phosphorylation by protein kinase Cδ (PKCδ) abrogates the inhibitory effect of C/EBPα on IL-10 production. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kang J.W., Park Y.S., Kim M.S., Lee D.H., Bak Y., Ham S.Y., Park S.H., Hong J.T., Yoon D.Y. IBD - Inflammatory bowel disease The PKC delta construct is described in Ref. 7-PMID:22927445. The identity of IL-32 beta was inferred from previous work of the authors (PMID:19740314). jinthong@chungbuk.ac.kr,ydy4218@konkuk.ac.kr J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation kang-2013b-1 Interleukin (IL)-32β-mediated CCAAT/enhancer-binding protein α (C/EBPα) phosphorylation by protein kinase Cδ (PKCδ) abrogates the inhibitory effect of C/EBPα on IL-10 production. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kang J.W., Park Y.S., Kim M.S., Lee D.H., Bak Y., Ham S.Y., Park S.H., Hong J.T., Yoon D.Y. IBD - Inflammatory bowel disease HEK293 cells were treated with phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) (20 nM) for 90 minutes before co-immunoprecipitation was performed. The PKC delta construct is described in Ref. 7-PMID:22927445. The identity of IL-32 beta was inferred from previous work of the authors (PMID:19740314). jinthong@chungbuk.ac.kr,ydy4218@konkuk.ac.kr J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation kang-2013b-3 Interleukin (IL)-32β-mediated CCAAT/enhancer-binding protein α (C/EBPα) phosphorylation by protein kinase Cδ (PKCδ) abrogates the inhibitory effect of C/EBPα on IL-10 production. human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kang J.W., Park Y.S., Kim M.S., Lee D.H., Bak Y., Ham S.Y., Park S.H., Hong J.T., Yoon D.Y. IBD - Inflammatory bowel disease The PKC delta construct is described in Ref. 7-PMID:22927445. The identity of IL-32 beta was inferred from previous work of the authors (PMID:19740314). jinthong@chungbuk.ac.kr,ydy4218@konkuk.ac.kr J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation kang-2013b-4 Interleukin (IL)-32β-mediated CCAAT/enhancer-binding protein α (C/EBPα) phosphorylation by protein kinase Cδ (PKCδ) abrogates the inhibitory effect of C/EBPα on IL-10 production. human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kang J.W., Park Y.S., Kim M.S., Lee D.H., Bak Y., Ham S.Y., Park S.H., Hong J.T., Yoon D.Y. IBD - Inflammatory bowel disease It has been assumed that transfected molecules were detected here;however the text is not clear as to whether endogenous or transfected molecules are being detected. The PKC delta construct is described in Ref. 7-PMID:22927445. The identity of IL-32 beta was inferred from previous work of the authors (PMID:19740314). jinthong@chungbuk.ac.kr,ydy4218@konkuk.ac.kr J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation kang-2013b-5 Interleukin (IL)-32β-mediated CCAAT/enhancer-binding protein α (C/EBPα) phosphorylation by protein kinase Cδ (PKCδ) abrogates the inhibitory effect of C/EBPα on IL-10 production. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kang J.W., Park Y.S., Kim M.S., Lee D.H., Bak Y., Ham S.Y., Park S.H., Hong J.T., Yoon D.Y. IBD - Inflammatory bowel disease While the figure legend states that immunoprecipitation was carried out with anti-Myc antibody, the figure indicates anti-IL-32 antibody was used for IP. As both the transfected IL-32 beta and C/EBP alpha constructs are fused to a Myc tag, the procedure according to the figure was chosen here and IL-32 beta was set as bait. The PKC delta construct is described in Ref. 7-PMID:22927445. The identity of IL-32 beta was inferred from previous work of the authors (PMID:19740314). jinthong@chungbuk.ac.kr,ydy4218@konkuk.ac.kr J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation p24001-2 Interleukin-32 Beta IL32 NK4 TAIF Natural killer cells protein 4 Tumor necrosis factor alpha-inducing factor protein protein human Homo sapiens Human MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK kpcd_human Protein kinase C delta type nPKC-delta PRKCD Tyrosine-protein kinase PRKCD PKCD protein protein human Homo sapiens Human MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED cebpa_human CCAAT/enhancer-binding protein alpha CEBPA CEBP protein protein human Homo sapiens Human MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA il10_human_gene Interleukin-10 (IL10) human gene gene gene human Homo sapiens Human trfl_human_gene Lactotransferrin (TRFL) human gene gene gene human Homo sapiens Human bcl2_human_gene Apoptosis regulator Bcl-2 BCL2 gene gene human Homo sapiens Human prkcd-il32-1 1597956 n/a 1597961 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597962 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3b phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) rottlerin (CHEBI:8899), a PKC delta inhibitor No IL-32 beta co-precipitated with anti-PKC delta antibody from cells not treated with PMA (CHEBI:37537). il32-cebpa 1597956 n/a 1597962 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597963 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597961 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6a, 6f phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) il32-cebpa-1 1597956 n/a 1597961 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597963 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6a cebpa-il32 1597956 n/a 1597963 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597961 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6b phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) rottlerin (CHEBI:8899), a PKC delta inhibitor il32-prkcd-9 1597957 n/a 1597962 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597961 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3a il32-cebpa-4 1597957 n/a 1597961 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597963 unspecified role unspecified role prey prey bzip domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7a cebpa-il32-1 1597957 n/a 1597963 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597961 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 7b cebpa-il10 1597958 n/a 1597963 unspecified role unspecified role bait bait n/a 1597964 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5 IL-32 beta knockdown P24001-2 decreases binding of P49715 to ENSG00000136634 cebpa-trfl 1597958 n/a 1597963 unspecified role unspecified role bait bait n/a 1597965 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5 cebpa-bcl2 1597958 n/a 1597966 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597963 unspecified role unspecified role bait bait association association false false false Fig. 5 il32-cebpa-2 1597959 n/a 1597961 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597963 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6c phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) rottlerin (CHEBI:8899), a PKC delta inhibitor il32-cebpa-3 1597960 n/a 1597961 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597963 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597962 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6g phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537)