IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ catar-2013-1 The proto-oncogene c-Fos transcriptionally regulates VEGF production during peritoneal inflammation. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Catar R., Witowski J., Wagner P., Annett Schramm I., Kawka E., Philippe A., Dragun D., Jörres A. IBD - Inflammatory bowel disease achim.joerres@charite.de Kidney Int. (0085-2538) 2013 Only protein-protein interactions imex curation vegfa_human_fos-site_dna-probe Human MMP1 gene promoter c-Fos binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGGTAGGTTTGAATCATCACGCAG fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL vegfa-fos-1 1766567 n/a 1766568 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1766569 unspecified role unspecified role prey prey human-pmc Homo sapiens peritoneal mesothelial cells pmc peritoneal mesothelial cells physical association physical association false false false Fig. 5c Transforming growth factor beta-1 (TGF-beta1) (P01137) Tumor necrosis factor alpha (TNF-alpha) (P01375) Interleukin-1 beta (IL-1beta) (P01584) The interaction was inhibited in the presence of '100-fold molar excess of unlabeled VEGF DNA / oligonucleotides'; however, the exact nature and sequence of the competitors could not be established, hence this interaction is not captured here. SR-11302, an inhibitor of the AP-1 transcription factor P01100 increases expression at protein level of ENSG00000112715 P01584 indirectly increases expression at protein level of ENSG00000112715 P01584 and P01137 indirectly increases expression at protein level of ENSG00000112715 P01137 indirectly increases expression at protein level of ENSG00000112715 P01137 indirectly increases expression at RNA level of ENSG00000112715 P01137 and P01375 indirectly increases expression at protein level of ENSG00000112715 P01137 and P01375 indirectly increases expression at RNA level of ENSG00000112715