IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gonsky-2013-1 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag fluorescence tag visualisation by fluorescence tag fluorescence Gonsky R., Deem RL., Targan SR. IBD - Inflammatory bowel disease No further details are available for Promega supplied c-Jun, as the product is no longer available. Stephan.Targan@cshs.org Cytokine 2013 imex curation Monocytes were isolated from PBMC using negative selection by depletion with magnetic beads. Only protein-protein interactions imex curation gonsky-2013-2 human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Gonsky R., Deem RL., Targan SR. IBD - Inflammatory bowel disease Monocytes were isolated from PBMC using negative selection by depletion with magnetic beads. Stephan.Targan@cshs.org Cytokine 2013 Only protein-protein interactions imex curation imex curation jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF tnfsf15_ap-1_site_probe TNFSF15_5-prime_UTR_AP-1_site dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGTGACTTTAATCACTCAGTCTCC ap1-consensus_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CGCTTGATGACTCAGCCGGAA tnf15_human_gene Tumor necrosis factor ligand superfamily member 15 TNFSF15 TL1 VEGI gene gene human Homo sapiens Human p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 tnfsf15_ap_1 site_probe-jun-1 1853275 N/A 1853277 unspecified role unspecified role prey prey N/A 1853278 unspecified role unspecified role bait bait 5-prime fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3C tnfsf15_ap_1_site_probe-ap1_consensus_probe-1 1853275 N/A 1853279 inhibitor inhibitor prey prey C13T,A14G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1853277 unspecified role unspecified role prey prey N/A 1853278 unspecified role unspecified role bait bait 5-prime fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3Ci tnfsf15_ap_1_site_probe-ap1_consensus_probe-2 1853275 N/A 1853278 inhibitor inhibitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1853277 unspecified role unspecified role prey prey N/A 1853278 unspecified role unspecified role bait bait 5-prime fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3Cii jun-tnfsf15-1 1853276 N/A 1853280 unspecified role unspecified role prey prey 5-prime_UTR_AP1_binding site sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853277 unspecified role unspecified role bait bait association association false false false 4 P05412 increases expression at RNA level of ENSG00000181634 CHEBI:87077 indirectly decreases expression at RNA level of ENSG00000181634 CHEBI:87077 indirectly decreases expression at protein level of ENSG00000181634 jun-tnfsf15-2 1853276 N/A 1853280 unspecified role unspecified role prey prey 5-prime_UTR_−210 bp_NFKb_binding_site sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853281 unspecified role unspecified role bait bait association association false false false 4i