IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wu-2013-2 mouse-t-cell_th17 Mouse Thelper 17 cells t-cell_th17 T-helper 17 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wu C., Yosef N., Thalhamer T., Zhu C., Xiao S., Kishi Y., Regev A., Kuchroo VK. IBD - Inflammatory bowel disease IL-23-restimulated TH17 cells aregev@broad.mit.edu,vkuchroo@rics.harvard.edu Nature 2013 imex curation Only protein-protein interactions imex curation wu-2013-3 mouse-t-cell_th17 Mouse Thelper 17 cells t-cell_th17 T-helper 17 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wu C., Yosef N., Thalhamer T., Zhu C., Xiao S., Kishi Y., Regev A., Kuchroo VK. IBD - Inflammatory bowel disease IL-23-restimulated TH17 cells aregev@broad.mit.edu,vkuchroo@rics.harvard.edu Nature 2013 Only protein-protein interactions imex curation imex curation foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG il23r_mouse_gene Interleukin-23 receptor gene gene mouse Mus musculus Mouse foxo1_mouse_gene Forkhead box protein O1 Foxo1 Fkhr Foxo1a gene gene mouse Mus musculus Mouse p51450-2 Nuclear receptor ROR-gamma RORgT Rorc Nr1f3 Rorg Thor Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 Retinoid-related orphan receptor-gamma Thymus orphan receptor RAR-related orphan receptor C protein protein mouse Mus musculus Mouse MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK Produced by alternative promoter usage. foxo1-il23r_mouse_gene-1 1853089 N/A 1853091 unspecified role unspecified role bait bait N/A 1853092 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3F, Supp fig 6D Q9WVC6 decreases binding of Q9R1E0 to ENSMUSG00000049093. Q9WVC6 decreases expression at RNA level of ENSMUSG00000049093. Q9WVC6 decreases expression at protein level of ENSMUSG00000049093. foxo1-foxo1-1 1853089 N/A 1853091 unspecified role unspecified role bait bait N/A 1853093 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp fig 6A rorc-il23r_mouse_gene-1 1853089 N/A 1853092 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853094 unspecified role unspecified role bait bait association association false false false Supp fig 6E foxo1-rorc-1 1853090 N/A 1853091 unspecified role unspecified role bait bait N/A 1853094 unspecified role unspecified role prey prey physical association physical association false false false 3H rorc-foxo1-1 1853090 N/A 1853091 unspecified role unspecified role prey prey N/A 1853094 unspecified role unspecified role bait bait physical association physical association false false false 3Hi