IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhou-2013d-1 Microenvironmental regulation of BRCA1 gene expression by c-Jun and Fra2 in premalignant human ovarian surface epithelial cells. human-iose Human immortalised ovarian epithelial cells (OSE) iose Immortalized ovarian epithelial cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhou L., Graves M., MacDonald G., Cipollone J., Mueller C.R., Roskelley C.D. IBD - Inflammatory bowel disease Human immortalised ovarian epithelial cells stably transfected with SV40 virus large T antigen were passed through crisis to generate the truly immortal, premalignant IOSE-80pc line used in these experiments. His-tagged human c-Jun and FRA-2/FOSL2 constructs are described in PMID:11708771. roskelly@mail.ubc.ca Mol. Cancer Res. (1541-7786) 2013 Only protein-protein interactions imex curation zhou-2013d-2 Microenvironmental regulation of BRCA1 gene expression by c-Jun and Fra2 in premalignant human ovarian surface epithelial cells. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Zhou L., Graves M., MacDonald G., Cipollone J., Mueller C.R., Roskelley C.D. IBD - Inflammatory bowel disease Human immortalised ovarian epithelial cells stably transfected with SV40 virus large T antigen were passed through crisis to generate the truly immortal, premalignant IOSE-80pc line used in these experiments. His-tagged human c-Jun and FRA-2/FOSL2 constructs are described in PMID:11708771. roskelly@mail.ubc.ca Mol. Cancer Res. (1541-7786) 2013 Only protein-protein interactions imex curation brca1_human_gene breast cancer 1, early onset gene gene human Homo sapiens Human gabpa_human GA-binding protein alpha chain Transcription factor E4TF1-60 Nuclear respiratory factor 2 subunit alpha GABPA E4TF1A protein protein human Homo sapiens Human MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN fosl2_human Fos-related antigen 2 FOSL2 FRA2 protein protein human Homo sapiens Human MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF brca1_human_cre-site_dna-probe Human BRCA1 gene promoter CRE site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CTTTCCTTTTACGTCATCCGGGGGCAGACT gabpa-brca1-1 1766790 n/a 1766792 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1766793 unspecified role unspecified role bait bait association association false false false Fig. 3a fosl2-brca1-1 1766790 n/a 1766792 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1766794 unspecified role unspecified role bait bait association association false false false Fig. 3a P15408 and P05412 increases expression at RNA level of ENSG00000012048 P15408 and P05412 increases expression at protein level of ENSG00000012048 jun-brca1-1 1766790 n/a 1766792 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1766795 unspecified role unspecified role bait bait association association false false false Fig. 3a brca1-fosl2-1 1766791 n/a 1766796 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c12a_g13t mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1766794 unspecified role unspecified role prey prey human-iose Human immortalised ovarian epithelial cells (OSE) iose Immortalized ovarian epithelial cells physical association physical association false false false Fig. 3d The interaction was reduced when nuclear extracts were obtained from cells maintained in suspension compared to cells maintained in monolayer culture. brca1-jun-1 1766791 n/a 1766795 unspecified role unspecified role prey prey human-iose Human immortalised ovarian epithelial cells (OSE) iose Immortalized ovarian epithelial cells n/a 1766796 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c12a_g13t mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 3d The interaction was reduced when nuclear extracts were obtained from cells maintained in suspension compared to cells maintained in monolayer culture.