IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ou-2013-1 Regulation of the human hydroxysteroid sulfotransferase (SULT2A1) by RORα and RORγ and its potential relevance to human liver diseases. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ou Z., Shi X., Gilroy R.K., Kirisci L., Romkes M., Lynch C., Wang H., Xu M., Jiang M., Ren S., Gramignoli R., Strom S.C., Huang M., Xie W. IBD - Inflammatory bowel disease Interactions determined by EMSA involving in vitro translated ROR-alpha, ROR-gamma and CAR/RXR-alpha as well as interactions determined by ChIP involving transfected HA-CAR, ROR-alpha and ROR-gamma are not captured here as the origin of the used constructs could not be established. wex6@pitt.edu,huangmin@mail.sysu.edu.cn Mol. Endocrinol. (0888-8809) 2013 Only protein-protein interactions imex curation st2a1_human_gene Bile salt sulfotransferase human gene gene gene human Homo sapiens Human rora_human Nuclear receptor ROR-alpha Retinoid-related orphan receptor-alpha Nuclear receptor RZR-alpha Nuclear receptor subfamily 1 group F member 1 RORA NR1F1 RZRA RAR-related orphan receptor A protein protein human Homo sapiens Human MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG rorg_human Nuclear receptor ROR-gamma RORC NR1F3 RORG RZRG Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 Retinoid-related orphan receptor-gamma RAR-related orphan receptor C protein protein human Homo sapiens Human MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK nr1i3_human Nuclear receptor subfamily 1 group I member 3 NR1I3 CAR Constitutive androstane receptor Constitutive activator of retinoid response Orphan nuclear receptor MB67 protein protein human Homo sapiens Human MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS rora-st2a1-1 1575407 n/a 1575408 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1575409 unspecified role unspecified role bait bait association association false false false Fig. 3a P35398 increases expression at RNA level of ENSG00000105398 rorc-st2a1-1 1575407 n/a 1575408 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1575410 unspecified role unspecified role bait bait association association false false false Fig. 3a P51449 increases expression at RNA level of ENSG00000105398 nr1i3-st2a1-1 1575407 n/a 1575411 unspecified role unspecified role bait bait n/a 1575408 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3a