IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2012m-1 Retinoic acid and tumor necrosis factor-α induced monocytic cell gene expression is regulated in part by induction of transcription factor MafB. human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zhang Y., Chen Q., Ross A.C. IBD - Inflammatory bowel disease acr6@psu.edu Exp. Cell Res. (0014-4827) 2012 Only protein-protein interactions imex curation mafb_human Transcription factor MafB MAFB KRML V-maf musculoaponeurotic fibrosarcoma oncogene homolog B protein protein human Homo sapiens Human MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATASATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL ccl2_human_gene C-C motif chemokine 2 CCL2 MCP1 SCYA2 HC11 Monocyte chemoattractant protein 1 Monocyte chemotactic and activating factor Monocyte chemotactic protein 1 Monocyte secretory protein JE Small-inducible cytokine A2 gene gene human Homo sapiens Human ticn1_human_gene Testican-1 (SPOCK1) human gene gene gene human Homo sapiens Human prdm1_human_gene PR domain zinc finger protein 1 (PRDM1) human gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG mafb-ccl2-1 1768056 n/a 1768057 unspecified role unspecified role bait bait n/a 1768058 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5b all-trans-retinoic acid (CHEBI:15367) and Tumor necrosis factor alpha (TNF-alpha) (P01375) CHEBI:15367 indirectly increases expression at RNA level of Q9Y5Q3 CHEBI:15367 indirectly increases expression at protein level of Q9Y5Q3 P01375 indirectly increases expression at RNA level of Q9Y5Q3 P01375 indirectly increases expression at protein level of Q9Y5Q3 CHEBI:15367 indirectly increases expression at RNA level of ENSG00000108691 P01375 indirectly increases expression at RNA level of ENSG00000108691 P01375 and CHEBI:15367 increases binding of Q9Y5Q3 to ENSG00000108691 Q9Y5Q3 increases expression at RNA level of ENSG00000108691 mafb-ticn1-1 1768056 n/a 1768057 unspecified role unspecified role bait bait n/a 1768059 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5b all-trans-retinoic acid (CHEBI:15367) and Tumor necrosis factor alpha (TNF-alpha) (P01375) CHEBI:15367 indirectly increases expression at RNA level of ENSG00000152377 P01375 indirectly increases expression at RNA level of ENSG00000152377 P01375 and CHEBI:15367 increases binding of Q9Y5Q3 to ENSG00000152377 Q9Y5Q3 increases expression at RNA level of ENSG00000152377 mafb-prdm1-1 1768056 n/a 1768057 unspecified role unspecified role bait bait n/a 1768060 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5b all-trans-retinoic acid (CHEBI:15367) and Tumor necrosis factor alpha (TNF-alpha) (P01375) CHEBI:15367 indirectly increases expression at RNA level of ENSG00000057657 P01375 indirectly increases expression at RNA level of ENSG00000057657 P01375 and CHEBI:15367 increases binding of Q9Y5Q3 to ENSG00000057657 Q9Y5Q3 increases expression at RNA level of ENSG00000057657 hist1h4a-ccl2-1 1768056 n/a 1768061 unspecified role unspecified role bait bait possible acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1768058 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5c all-trans-retinoic acid (CHEBI:15367) and Tumor necrosis factor alpha (TNF-alpha) (P01375) P01375 and CHEBI:15367 increases binding of P62805 to ENSG00000108691 hist1h4a-ticn1-1 1768056 n/a 1768061 unspecified role unspecified role bait bait possible acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1768059 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5c all-trans-retinoic acid (CHEBI:15367) and Tumor necrosis factor alpha (TNF-alpha) (P01375) P01375 and CHEBI:15367 increases binding of P62805 to ENSG00000152377 hist1h4a-prdm1-1 1768056 n/a 1768061 unspecified role unspecified role bait bait possible acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1768060 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a, 5c all-trans-retinoic acid (CHEBI:15367) and Tumor necrosis factor alpha (TNF-alpha) (P01375) P01375 and CHEBI:15367 increases binding of P62805 to ENSG00000057657