IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jia-2012-1 Tissue factor/activated factor VIIa induces matrix metalloproteinase-7 expression through activation of c-Fos via ERK1/2 and p38 MAPK signaling pathways in human colon cancer cell. human-lovo Homo sapiens colon adenocarcinoma cell line lovo lovo colon adenocarcinoma cell line lovo ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Jia Z.C., Wan Y.L., Tang J.Q., Dai Y., Liu Y.C., Wang X., Zhu J. IBD - Inflammatory bowel disease wan@bjmu.edu.cn,doc-tjq@hotmail.com Int J Colorectal Dis (0179-1958) 2012 Only protein-protein interactions imex curation fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL mmp7_human_gene Matrilysin (MMP7) human gene gene gene human Homo sapiens Human fos-mmp7-1 1771700 n/a 1771701 unspecified role unspecified role bait bait n/a 1771702 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2c human Coagulation factor VIIa (FVIIa) (P08709) (100nM for 2 hours) P08709 increases binding of P01100 to ENSG00000137673 P08709 indirectly increases expression at RNA level of ENSG00000137673 P08709 indirectly increases expression at protein level of ENSG00000137673 P01100 increases expression at protein level of ENSG00000137673 P08709 indirectly increases expression at protein level of P01100