IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hedrich-2011-2 cAMP-responsive element modulator (CREM)α protein signaling mediates epigenetic remodeling of the human interleukin-2 gene: implications in systemic lupus erythematosus. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Hedrich C.M., Rauen T., Tsokos G.C. IBD - Inflammatory bowel disease The human CREM-alpha expression construct is described in PMID:15691874 and PMID:11932306. The human DNMT3a expression construct is described in PMID:21346232. chedrich@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation hedrich-2011-3 cAMP-responsive element modulator (CREM)α protein signaling mediates epigenetic remodeling of the human interleukin-2 gene: implications in systemic lupus erythematosus. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hedrich C.M., Rauen T., Tsokos G.C. IBD - Inflammatory bowel disease The human CREM-alpha expression construct is described in PMID:15691874 and PMID:11932306. The human DNMT3a expression construct is described in PMID:21346232. chedrich@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation hedrich-2011-1 cAMP-responsive element modulator (CREM)α protein signaling mediates epigenetic remodeling of the human interleukin-2 gene: implications in systemic lupus erythematosus. human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Hedrich C.M., Rauen T., Tsokos G.C. IBD - Inflammatory bowel disease The human CREM-alpha expression construct is described in PMID:15691874 and PMID:11932306. The human DNMT3a expression construct is described in PMID:21346232. chedrich@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA dnm3a_human DNA (cytosine-5)-methyltransferase 3A DNMT3A DNA methyltransferase HsaIIIA Cysteine methyltransferase DNMT3A protein protein human Homo sapiens Human MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV crem-il2-2 1767663 n/a 1767666 unspecified role unspecified role bait bait n/a 1767667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2c Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly increased in the latter. Q03060 decreases expression at RNA level of ENSG00000109471 hdac1-il2-2 1767663 n/a 1767668 unspecified role unspecified role bait bait n/a 1767667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4b Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly increased in the latter. dnmt3a-il2 1767663 n/a 1767667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767669 unspecified role unspecified role bait bait association association false false false Fig. 7b Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly increased in the latter. Q9Y6K1 decreases expression at RNA level of ENSG00000109471 crem-dnmt3a 1767664 n/a 1767669 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n/a 1767666 unspecified role unspecified role bait bait naturally occurring naturally occurring endogenous endogenous physical association physical association false false false Fig. 7a crem-dnmt3a-2 1767664 n/a 1767666 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n/a 1767669 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 7a crem-il2-1 1767665 n/a 1767667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767666 unspecified role unspecified role bait bait association association false false false Fig. 2b anti-CD3 and anti-CD28 antibodies Chromatin was immunoprecipitated from both naïve CD4+ T cells and CD4+ T cells activated by incubation in the presence of plate-bound anti-CD3 and anti-CD28 antibodies. The interaction was significantly increased in activated CD4+ T cells.