IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ toscano-2011-1 human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Toscano MA., Campagna L., Molinero LL., Cerliani JP., Croci DO., Ilarregui JM., Fuertes MB., Nojek IM., Fededa JP., Zwirner NW., Costas MA., Rabinovich GA. IBD - Inflammatory bowel disease Results from an acetyl-H3 ChIp have not been included due to lack of antibody specificity. Cells were pre-incubated with PHA. martalitos@yahoo.com.ar,gabriel.r@ibyme.conicet.gov.ar,gabyrabi@gmail.com Molecular immunology 2011 Only protein-protein interactions imex curation imex curation p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 leg1_human_gene Galectin-1 LGALS1 gene gene human Homo sapiens Human nfkb1-lgals1-1 1860788 N/A 1860789 unspecified role unspecified role bait bait N/A 1860790 unspecified role unspecified role prey prey G1-7_region_intron1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4B