IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ maruyama-2011-1 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Maruyama T., Li J., Vaque JP., Konkel JE., Wang W., Zhang B., Zhang P., Zamarron BF., Yu D., Wu Y., Zhuang Y., Gutkind JS., Chen W. IBD - Inflammatory bowel disease In the text it has been assumed that the term "Foxp3 promoter" refers to the proximal promoter region, unless stated otherwise. naive CD4+ T cells (stimulated by anti-CD3/28, with or without TGF-beta) or CD4+CD25+ Treg cells TGF-beta1 is Human in origin;as stated in methods. wchen@dir.nidcr.nih.gov Nature immunology 2011 Only protein-protein interactions imex curation imex curation foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse p15806-2 Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQLHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL Contains a phosphothreonine at position 528. Contains a phosphoserine at position 533. tbp_mouse TATA-box-binding protein Tbp Tfiid TATA sequence-binding protein TATA-binding factor TATA-box factor Transcription initiation factor TFIID TBP subunit protein protein mouse Mus musculus Mouse MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT gata3_mouse Trans-acting T-cell-specific transcription factor GATA-3 Gata3 Gata-3 GATA-binding factor 3 protein protein mouse Mus musculus Mouse MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSGLSFGPHHPSSMVTAMG rorg_mouse_gene Nuclear receptor ROR-gamma gene gene mouse Mus musculus Mouse tcf3-foxp3-1 1859278 N/A 1859279 unspecified role unspecified role prey prey amplicon2_proximal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false amplicon1_distal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859280 unspecified role unspecified role bait bait association association false false false 3B TGF-beta was present throughout tcf3-foxp3-2 1859278 N/A 1859279 unspecified role unspecified role prey prey amplicon2_proximal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859280 unspecified role unspecified role bait bait association association false false false 3 C/D/E, 4F, 5G,Supp 6 P01137 -TGF-beta1 P01137 increases the binding of P15806-2 to ENSMUSG00000039521 P15806-2 is required for the P01137 induced expression at RNA level of ENSMUSG00000039521 P41133 increases the binding of P15806-2 to ENSMUSG00000039521 Q64729 is required for the binding of P15806-2 to ENSMUSG00000039521 Freshly isolated spleen CD4+CD25+ TReg cells showed increased binding as compared to CD4+CD25− T cells (not treated with TGF-beta). This effect is not seen in Id3–/– mice. foxp3-tcf3-1 1859278 N/A 1859279 unspecified role unspecified role prey prey amplicon2_proximal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859281 unspecified role unspecified role bait bait association association false false false 3 D P01137 -TGF-beta1 P01137 increases the binding of P29037 to ENSMUSG00000039521 gata3-foxp3-1 1859278 N/A 1859279 unspecified role unspecified role prey prey amplicon2_proximal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859282 unspecified role unspecified role bait bait association association false false false 5F P01137 decreases the binding of P23772 to ENSMUSG00000039521. P41133 decreases the binding of P23772 to ENSMUSG00000039521. P01137 decreases the expression at RNA level of P23772. P41133 decreases the expression at RNA level of P23772. P41133 decreases the expression at protein level of P23772. tcf3-rorg_mouse_gene-1 1859278 N/A 1859283 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859280 unspecified role unspecified role bait bait association association false false false Supp 8A P01137 increases the binding of P15806-2 to ENSMUSG00000028150 P01137 -TGF-beta P15806-2 increases expression at RNA level of ENSMUSG00000028150