IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-2010-3 mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Xu L., Kitani A., Stuelten C., McGrady G., Fuss I., Strober W. IBD - Inflammatory bowel disease Cells were stimulated with plate-bound anti-CD3/28 and TGF-beta. wstrober@niaid.nih.gov Immunity 2010 Only protein-protein interactions imex curation imex curation h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS hist1h4h-foxp3-5 1860825 N/A 1860826 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1860827 unspecified role unspecified role prey prey enhancer_1_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7A TGF-beta1 TGF-beta1 and retinoic acid In the absence of TGF-beta1 stimulation there was little binding; TGF-beta1 caused a slight increase in binding and the combination of TGF-beta1 and RA caused a large increase in binding. RA alone had no effect. hist1h4h-foxp3-6 1860825 N/A 1860826 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1860827 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7Ai TGF-beta1 all trans Retinoic acid -CHEBI:15367 CHEBI:15367 increases the binding of P62806 to ENSMUSG00000039521 In the absence of stimulation,some binding to the promoter region was seen; this binding was increased by TGF-beta1 and/or RA. CHEBI:15367 increases the expression at protein level of ENSMUSG00000039521 CHEBI:88340 causes no change to CHEBI:15367 increasing the expression at protein level of ENSMUSG00000039521 CHEBI:4031 causes no change to CHEBI:15367 increasing the expression at protein level of ENSMUSG00000039521 Q8NEV9 and Q14213 decrease CHEBI:15367 increasing the expression at protein level of ENSMUSG00000039521 smad3-foxp3-5 1860825 N/A 1860828 unspecified role unspecified role bait bait N/A 1860827 unspecified role unspecified role prey prey enhancer_1_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7 B/C TGF-beta1 TGF-beta1 and retinoic acid IL-27 (heterodimer of Q8NEV9 and Q14213 mature proteins - minus signal sequences) Q8NEV9 and Q14213 decrease the binding of Q8BUN5 to ENSMUSG00000039521 JNK kinase inhibitor 1: CHEBI:88340 CHEBI:88340 decrease the binding of Q8BUN5 to ENSMUSG00000039521 CHEBI:88340 decreases at protein level the expression of ENSMUSG00000039521 CHEMBL440084 decreases at protein level the expression of ENSMUSG00000039521 Q8NEV9 and Q14213 decrease expression at protein level of ENSMUSG00000039521 P42227 decreases the decrease of expression at protein level of ENSMUSG00000039521 by Q8NEV9 and Q14213 O35718 increases the decrease of expression at protein level of ENSMUSG00000039521 by Q8NEV9 and Q14213 CHEBI:15367 causes no change to Q8NEV9 and Q14213 induced phosphorylation of P42227 Q8BUN5 is required for the expression at protein level of ENSMUSG00000039521 CHEBI:15367 increases expression of (total) Q8BUN5 (in the absence of TGF-beta) CHEBI:15367 causes no change to phosphorylation of Q8BUN5 (in the absence of TGF-beta)