IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ okamoto-2010-1 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Okamoto T., Inozume T., Mitsui H., Kanzaki M., Harada K., Shibagaki N., Shimada S. Cancer - Interactions investigated in the context of cancer Nuclear extracts of NIH3T3 cells with v-Src cDNA stably-transfected were used. naotakas@yamanashi.ac.jp Molecular cancer therapeutics 2010 Only protein-protein interactions imex curation imex curation IBD - Inflammatory bowel disease okamoto-2010-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Okamoto T., Inozume T., Mitsui H., Kanzaki M., Harada K., Shibagaki N., Shimada S. Cancer - Interactions investigated in the context of cancer Nuclear extracts of NIH3T3 cells with v-Src cDNA stably-transfected were used. naotakas@yamanashi.ac.jp Molecular cancer therapeutics 2010 Only protein-protein interactions imex curation imex curation IBD - Inflammatory bowel disease probe-mouse_stat3_hsie_ binding_ site Probe- High Affinity Serum Inducible Site ds dna double stranded deoxyribonucleic acid ds DNA ds dna mouse Mus musculus Mouse CATTTCCCGTAAATC stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM nduad_mouse NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Ndufa13 Grim19 Cell death regulatory protein GRIM-19 Complex I-B16.6 Gene associated with retinoic and interferon-induced mortality 19 protein NADH-ubiquinone oxidoreductase B16.6 subunit protein protein mouse Mus musculus Mouse MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT probe_mouse_stat3_hsie_ binding_ site-stat3-1 1854343 N/A 1854345 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1854346 unspecified role unspecified role prey prey physical association physical association false false false 2E Q9ERS2 decreases expression at protein level of P10417 Q9ERS2 decreases expression at protein level of Q64373-1 Q9ERS2 decreases expression at RNA level of P42227 ndufa13-stat3-1 1854344 N/A 1854346 unspecified role unspecified role prey prey cell lysate cell lysate mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells N/A 1854347 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminal_polyarginine (R9)-PTD cell penetrating pep cell penetrating peptide tag CPPs membrane translocating sequences MTS cell-penetrating peptides PTDs Trojan peptides protein transduction domains cell penetrating pep n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supplementary figure 3