IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ polansky-2010-1 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Polansky JK., Schreiber L., Thelemann C., Ludwig L., Krüger M., Baumgrass R., Cording S., Floess S., Hamann A., Huehn J. IBD - Inflammatory bowel disease CD25+ TReg cells isolated from pooled spleen and lymph node cells. jochen.huehn@helmholtz-hzi.de Journal of molecular medicine (Berlin, Germany) 2010 Only protein-protein interactions imex curation imex curation ets1_mouse Protein C-ets-1 Ets1 Ets-1 p54 protein protein mouse Mus musculus Mouse MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse ets1-foxp3-1 1853628 N/A 1853629 unspecified role unspecified role bait bait N/A 1853630 unspecified role unspecified role prey prey tsdr(Treg-specific demethylated region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 8 B/C Binding to the TSDR could only be detected in the Treg population, but only in Aza-induced Foxp3+ Tregs, not in TGF-beta-induced Foxp3+ Tregs. 5-Aza-2′-deoxycytidine (CHEBI:50131) - a demethylating agent CHEBI:50131 increases binding of P27577 to ENSMUSG00000039521